Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (12 Aug 2020)
Sequence version 2 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sodium/hydrogen exchanger 9B1

Gene

SLC9B1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sperm-specific Na+/H+ exchanger involved in intracellular pH regulation of spermatozoa. Involved in sperm motility and fertility.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAntiport, Fertilization, Ion transport, Sodium transport, Transport
LigandSodium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q4ZJI4

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351, Stimuli-sensing channels

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.36.2.3, the monovalent cation:proton antiporter-1 (cpa1) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium/hydrogen exchanger 9B1
Alternative name(s):
Na(+)/H(+) exchanger-like domain-containing protein 1
Short name:
NHE domain-containing protein 1
Sodium/hydrogen exchanger-like domain-containing protein 11 Publication
Solute carrier family 9, subfamily B member 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC9B1Imported
Synonyms:NHA1Imported, NHEDC11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164037.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24244, SLC9B1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611527, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4ZJI4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei66 – 86HelicalSequence analysisAdd BLAST21
Transmembranei95 – 115HelicalSequence analysisAdd BLAST21
Transmembranei116 – 136HelicalSequence analysisAdd BLAST21
Transmembranei152 – 172HelicalSequence analysisAdd BLAST21
Transmembranei187 – 207HelicalSequence analysisAdd BLAST21
Transmembranei215 – 235HelicalSequence analysisAdd BLAST21
Transmembranei260 – 280HelicalSequence analysisAdd BLAST21
Transmembranei284 – 304HelicalSequence analysisAdd BLAST21
Transmembranei337 – 357HelicalSequence analysisAdd BLAST21
Transmembranei368 – 388HelicalSequence analysisAdd BLAST21
Transmembranei407 – 427HelicalSequence analysisAdd BLAST21
Transmembranei431 – 451HelicalSequence analysisAdd BLAST21
Transmembranei472 – 492HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Cell projection, Cilium, Flagellum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
150159

Open Targets

More...
OpenTargetsi
ENSG00000164037

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162397486

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q4ZJI4, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC9B1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439240

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003140071 – 515Sodium/hydrogen exchanger 9B1Add BLAST515

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q4ZJI4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4ZJI4

PeptideAtlas

More...
PeptideAtlasi
Q4ZJI4

PRoteomics IDEntifications database

More...
PRIDEi
Q4ZJI4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62386 [Q4ZJI4-1]
62387 [Q4ZJI4-2]
62388 [Q4ZJI4-3]
62389 [Q4ZJI4-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4ZJI4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4ZJI4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed only in the testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164037, Expressed in testis and 116 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4ZJI4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4ZJI4, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000164037, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000296422

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q4ZJI4, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3826, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013285

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_201317_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4ZJI4

KEGG Orthology (KO)

More...
KOi
K23994

Identification of Orthologs from Complete Genome Data

More...
OMAi
HLESYSK

Database of Orthologous Groups

More...
OrthoDBi
833306at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4ZJI4

TreeFam database of animal gene trees

More...
TreeFami
TF319087

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1530.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006153, Cation/H_exchanger
IPR038770, Na+/solute_symporter_sf
IPR030187, SLC9B1

The PANTHER Classification System

More...
PANTHERi
PTHR31102:SF5, PTHR31102:SF5, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00999, Na_H_Exchanger, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4ZJI4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHTTESKNEH LEDENFQTST TPQSLIDPNN TAQEETKTVL SDTEEIKPQT
60 70 80 90 100
KKETYISCPL RGVLNVIITN GVILFVIWCM TWSILGSEAL PGGNLFGLFI
110 120 130 140 150
IFYSAIIGGK ILQLIRIPLV PPLPPLLGML LAGFTIRNVP FINEHVHVPN
160 170 180 190 200
TWSSILRSIA LTIILIRAGL GLDPQALRHL KVVCFRLAVG PCLMEASAAA
210 220 230 240 250
VFSHFIMKFP WQWAFLLGFV LGAVSPAVVV PYMMVLQENG YGVEEGIPTL
260 270 280 290 300
LMAASSMDDI LAITGFNTCL SIVFSSGGIL NNAIASIRNV CISLLAGIVL
310 320 330 340 350
GFFVRYFPSE DQKKLTLKRG FLVLTMCVSA VLGSQRIGLH GSGGLCTLVL
360 370 380 390 400
SFIAGTKWSQ EKMKVQKIIT TVWDIFQPLL FGLVGAEVSV SSLESNIVGI
410 420 430 440 450
SVATLSLALC VRILTTYLLM CFAGFSFKEK IFIALAWMPK ATVQAVLGPL
460 470 480 490 500
ALETARVSAP HLEPYAKDVM TVAFLAILIT APNGALLMGI LGPKMLTRHY
510
DPSKIKLQLS TLEHH
Length:515
Mass (Da):56,054
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i37E89E22A8A910E5
GO
Isoform 2 (identifier: Q4ZJI4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.
     445-515: AVLGPLALET...KLQLSTLEHH → INQAILLLFLLREEWTNCKVAKKCEYTKERQ

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:243
Mass (Da):26,597
Checksum:i83F25B421DC4F400
GO
Isoform 3 (identifier: Q4ZJI4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     445-515: AVLGPLALET...KLQLSTLEHH → INQAILLLFLLREEWTNCKVAKKCEYTKERQ

Show »
Length:475
Mass (Da):52,180
Checksum:iD14FDA43C7F7CD44
GO
Isoform 4 (identifier: Q4ZJI4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-73: GVI → VLF
     74-515: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:73
Mass (Da):8,292
Checksum:i97A79AA3E2575845
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RHJ0D6RHJ0_HUMAN
Sodium/hydrogen exchanger 9B1
SLC9B1
254Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFK4D6RFK4_HUMAN
Sodium/hydrogen exchanger 9B1
SLC9B1
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9Z0H0Y9Z0_HUMAN
Sodium/hydrogen exchanger 9B1
SLC9B1
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGI9D6RGI9_HUMAN
Sodium/hydrogen exchanger 9B1
SLC9B1
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RA80D6RA80_HUMAN
Sodium/hydrogen exchanger 9B1
SLC9B1
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAM22868 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti292I → T in AAS91021 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06137033Q → H5 PublicationsCorresponds to variant dbSNP:rs2715591Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0301751 – 232Missing in isoform 2. 1 PublicationAdd BLAST232
Alternative sequenceiVSP_03017671 – 73GVI → VLF in isoform 4. 1 Publication3
Alternative sequenceiVSP_03017774 – 515Missing in isoform 4. 1 PublicationAdd BLAST442
Alternative sequenceiVSP_030180445 – 515AVLGP…TLEHH → INQAILLLFLLREEWTNCKV AKKCEYTKERQ in isoform 2 and isoform 3. 2 PublicationsAdd BLAST71

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ003059 mRNA Translation: AAY21808.1
AF447585 mRNA Translation: AAM22868.1 Frameshift.
AY461581 mRNA Translation: AAS91021.1
AC018797 Genomic DNA No translation available.
AC083826 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06152.1
BC022079 mRNA No translation available.
BC046636 mRNA No translation available.
BC110794 mRNA Translation: AAI10795.1
BC132712 mRNA Translation: AAI32713.1
BC136966 mRNA Translation: AAI36967.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34041.1 [Q4ZJI4-1]
CCDS47119.1 [Q4ZJI4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001094344.1, NM_001100874.2 [Q4ZJI4-3]
NP_631912.2, NM_139173.3 [Q4ZJI4-1]
XP_006714156.1, XM_006714093.3
XP_011529924.1, XM_011531622.1
XP_011529925.1, XM_011531623.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296422; ENSP00000296422; ENSG00000164037 [Q4ZJI4-1]
ENST00000394789; ENSP00000378269; ENSG00000164037 [Q4ZJI4-3]
ENST00000503584; ENSP00000426926; ENSG00000164037 [Q4ZJI4-5]
ENST00000510243; ENSP00000425913; ENSG00000164037 [Q4ZJI4-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
150159

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:150159

UCSC genome browser

More...
UCSCi
uc003hwu.4, human [Q4ZJI4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ003059 mRNA Translation: AAY21808.1
AF447585 mRNA Translation: AAM22868.1 Frameshift.
AY461581 mRNA Translation: AAS91021.1
AC018797 Genomic DNA No translation available.
AC083826 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06152.1
BC022079 mRNA No translation available.
BC046636 mRNA No translation available.
BC110794 mRNA Translation: AAI10795.1
BC132712 mRNA Translation: AAI32713.1
BC136966 mRNA Translation: AAI36967.1
CCDSiCCDS34041.1 [Q4ZJI4-1]
CCDS47119.1 [Q4ZJI4-3]
RefSeqiNP_001094344.1, NM_001100874.2 [Q4ZJI4-3]
NP_631912.2, NM_139173.3 [Q4ZJI4-1]
XP_006714156.1, XM_006714093.3
XP_011529924.1, XM_011531622.1
XP_011529925.1, XM_011531623.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9606.ENSP00000296422

Protein family/group databases

TCDBi2.A.36.2.3, the monovalent cation:proton antiporter-1 (cpa1) family

PTM databases

iPTMnetiQ4ZJI4
PhosphoSitePlusiQ4ZJI4

Polymorphism and mutation databases

BioMutaiSLC9B1
DMDMi296439240

Proteomic databases

MassIVEiQ4ZJI4
PaxDbiQ4ZJI4
PeptideAtlasiQ4ZJI4
PRIDEiQ4ZJI4
ProteomicsDBi62386 [Q4ZJI4-1]
62387 [Q4ZJI4-2]
62388 [Q4ZJI4-3]
62389 [Q4ZJI4-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26068, 90 antibodies

The DNASU plasmid repository

More...
DNASUi
150159

Genome annotation databases

EnsembliENST00000296422; ENSP00000296422; ENSG00000164037 [Q4ZJI4-1]
ENST00000394789; ENSP00000378269; ENSG00000164037 [Q4ZJI4-3]
ENST00000503584; ENSP00000426926; ENSG00000164037 [Q4ZJI4-5]
ENST00000510243; ENSP00000425913; ENSG00000164037 [Q4ZJI4-5]
GeneIDi150159
KEGGihsa:150159
UCSCiuc003hwu.4, human [Q4ZJI4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
150159
DisGeNETi150159
EuPathDBiHostDB:ENSG00000164037.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC9B1
HGNCiHGNC:24244, SLC9B1
HPAiENSG00000164037, Tissue enriched (testis)
MIMi611527, gene
neXtProtiNX_Q4ZJI4
OpenTargetsiENSG00000164037
PharmGKBiPA162397486

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3826, Eukaryota
GeneTreeiENSGT00390000013285
HOGENOMiCLU_201317_0_0_1
InParanoidiQ4ZJI4
KOiK23994
OMAiHLESYSK
OrthoDBi833306at2759
PhylomeDBiQ4ZJI4
TreeFamiTF319087

Enzyme and pathway databases

PathwayCommonsiQ4ZJI4
ReactomeiR-HSA-2672351, Stimuli-sensing channels

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
150159, 367 hits in 848 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC9B1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
150159
PharosiQ4ZJI4, Tbio

Protein Ontology

More...
PROi
PR:Q4ZJI4
RNActiQ4ZJI4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164037, Expressed in testis and 116 other tissues
ExpressionAtlasiQ4ZJI4, baseline and differential
GenevisibleiQ4ZJI4, HS

Family and domain databases

Gene3Di1.20.1530.20, 1 hit
InterProiView protein in InterPro
IPR006153, Cation/H_exchanger
IPR038770, Na+/solute_symporter_sf
IPR030187, SLC9B1
PANTHERiPTHR31102:SF5, PTHR31102:SF5, 1 hit
PfamiView protein in Pfam
PF00999, Na_H_Exchanger, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSL9B1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4ZJI4
Secondary accession number(s): A1KXV1
, B9EH04, C9JBP7, Q49A30, Q8NCV2, Q8WVZ0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: August 12, 2020
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again