Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (12 Aug 2020)
Sequence version 4 (15 Jun 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Fibronectin type III domain-containing protein 1

Gene

FNDC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be an activator of G protein signaling.By similarity

Caution

It is uncertain whether Met-1 or Met-53 is the initiator.Curated

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q4ZHG4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fibronectin type III domain-containing protein 1
Alternative name(s):
Activation-associated cDNA protein
Expressed in synovial lining protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FNDC1
Synonyms:FNDC2, KIAA1866, MEL4B3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164694.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21184, FNDC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609991, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4ZHG4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84624

Open Targets

More...
OpenTargetsi
ENSG00000164694

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134906656

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q4ZHG4, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FNDC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
298286926

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 32Sequence analysisAdd BLAST32
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000028483133 – 1894Fibronectin type III domain-containing protein 1Add BLAST1862

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi149N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei717PhosphoserineBy similarity1
Glycosylationi1661N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q4ZHG4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q4ZHG4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4ZHG4

PeptideAtlas

More...
PeptideAtlasi
Q4ZHG4

PRoteomics IDEntifications database

More...
PRIDEi
Q4ZHG4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62382 [Q4ZHG4-1]
62383 [Q4ZHG4-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q4ZHG4, 3 sites, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4ZHG4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4ZHG4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Almost absent from healthy skin; especially in epidermal keratinocytes, skin fibroblasts or endothelial cells and is barely detectable in benign melanocytic naevi. Expressed in the stroma close to skin tumors, in the tumor cells themselves and in the epidermis of psoriasis.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By TGFB1 present in the melanoma cell conditioned medium (MCCM).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164694, Expressed in layer of synovial tissue and 151 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4ZHG4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4ZHG4, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000164694, Tissue enhanced (thyroid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000297267

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q4ZHG4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4ZHG4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini39 – 131Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST93
Domaini158 – 258Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST101
Domaini262 – 357Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini362 – 457Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST96
Domaini1658 – 1752Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST95

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi671 – 773Ser-richAdd BLAST103
Compositional biasi1443 – 1516Thr-richAdd BLAST74

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4221, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063558

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002998_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4ZHG4

Identification of Orthologs from Complete Genome Data

More...
OMAi
WDYKQVS

Database of Orthologous Groups

More...
OrthoDBi
46073at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4ZHG4

TreeFam database of animal gene trees

More...
TreeFami
TF337588

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063, FN3, 5 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041, fn3, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060, FN3, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265, SSF49265, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853, FN3, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4ZHG4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPEAGATLR APRRLSWAAL LLLAALLPVA SSAAASVDHP LKPRHVKLLS
60 70 80 90 100
TKMGLKVTWD PPKDATSRPV EHYNIAYGKS LKSLKYIKVN AETYSFLIED
110 120 130 140 150
VEPGVVYFVL LTAENHSGVS RPVYRAESPP GGEWIEIDGF PIKGPGPFNE
160 170 180 190 200
TVTEKEVPNK PLRVRVRSSD DRLSVAWKAP RLSGAKSPRR SRGFLLGYGE
210 220 230 240 250
SGRKMNYVPL TRDERTHEIK KLASESVYVV SLQSMNSQGR SQPVYRAALT
260 270 280 290 300
KRKISEEDEL DVPDDISVRV MSSQSVLVSW VDPVLEKQKK VVASRQYTVR
310 320 330 340 350
YREKGELARW DYKQIANRRV LIENLIPDTV YEFAVRISQG ERDGKWSTSV
360 370 380 390 400
FQRTPESAPT TAPENLNVWP VNGKPTVVAA SWDALPETEG KVKEYILSYA
410 420 430 440 450
PALKPFGAKS LTYPGDTTSA LVDGLQPGER YLFKIRATNR RGLGPHSKAF
460 470 480 490 500
IVAMPTTSKA DVEQNTEDNG KPEKPEPSSP SPRAPASSQH PSVPASPQGR
510 520 530 540 550
NAKDLLLDLK NKILANGGAP RKPQLRAKKA EELDLQSTEI TGEEELGSRE
560 570 580 590 600
DSPMSPSDTQ DQKRTLRPPS RHGHSVVAPG RTAVRARMPA LPRREGVDKP
610 620 630 640 650
GFSLATQPRP GAPPSASASP AHHASTQGTS HRPSLPASLN DNDLVDSDED
660 670 680 690 700
ERAVGSLHPK GAFAQPRPAL SPSRQSPSSV LRDRSSVHPG AKPASPARRT
710 720 730 740 750
PHSGAAEEDS SASAPPSRLS PPHGGSSRLL PTQPHLSSPL SKGGKDGEDA
760 770 780 790 800
PATNSNAPSR STMSSSVSSH LSSRTQVSEG AEASDGESHG DGDREDGGRQ
810 820 830 840 850
AEATAQTLRA RPASGHFHLL RHKPFAANGR SPSRFSIGRG PRLQPSSSPQ
860 870 880 890 900
STVPSRAHPR VPSHSDSHPK LSSGIHGDEE DEKPLPATVV NDHVPSSSRQ
910 920 930 940 950
PISRGWEDLR RSPQRGASLH RKEPIPENPK STGADTHPQG KYSSLASKAQ
960 970 980 990 1000
DVQQSTDADT EGHSPKAQPG STDRHASPAR PPAARSQQHP SVPRRMTPGR
1010 1020 1030 1040 1050
APQQQPPPPV ATSQHHPGPQ SRDAGRSPSQ PRLSLTQAGR PRPTSQGRSH
1060 1070 1080 1090 1100
SSSDPYTASS RGMLPTALQN QDEDAQGSYD DDSTEVEAQD VRAPAHAARA
1110 1120 1130 1140 1150
KEAAASLPKH QQVESPTGAG AGGDHRSQRG HAASPARPSR PGGPQSRARV
1160 1170 1180 1190 1200
PSRAAPGKSE PPSKRPLSSK SQQSVSAEDD EEEDAGFFKG GKEDLLSSSV
1210 1220 1230 1240 1250
PKWPSSSTPR GGKDADGSLA KEEREPAIAL APRGGSLAPV KRPLPPPPGS
1260 1270 1280 1290 1300
SPRASHVPSR LPPRSAATVS PVAGTHPWPQ YTTRAPPGHF STTPMLSLRQ
1310 1320 1330 1340 1350
RMMHARFRNP LSRQPARPSY RQGYNGRPNV EGKVLPGSNG KPNGQRIING
1360 1370 1380 1390 1400
PQGTKWVVDL DRGLVLNAEG RYLQDSHGNP LRIKLGGDGR TIVDLEGTPV
1410 1420 1430 1440 1450
VSPDGLPLFG QGRHGTPLAN AQDKPILSLG GKPLVGLEVI KKTTHPPTTT
1460 1470 1480 1490 1500
MQPTTTTTPL PTTTTPRPTT ATTRRTTTTR RTTTRRPTTT VRTTTRTTTT
1510 1520 1530 1540 1550
TTPTPTTPIP TCPPGTLERH DDDGNLIMSS NGIPECYAEE DEFSGLETDT
1560 1570 1580 1590 1600
AVPTEEAYVI YDEDYEFETS RPPTTTEPST TATTPRVIPE EGAISSFPEE
1610 1620 1630 1640 1650
EFDLAGRKRF VAPYVTYLNK DPSAPCSLTD ALDHFQVDSL DEIIPNDLKK
1660 1670 1680 1690 1700
SDLPPQHAPR NITVVAVEGC HSFVIVDWDK ATPGDVVTGY LVYSASYEDF
1710 1720 1730 1740 1750
IRNKWSTQAS SVTHLPIENL KPNTRYYFKV QAQNPHGYGP ISPSVSFVTE
1760 1770 1780 1790 1800
SDNPLLVVRP PGGEPIWIPF AFKHDPSYTD CHGRQYVKRT WYRKFVGVVL
1810 1820 1830 1840 1850
CNSLRYKIYL SDNLKDTFYS IGDSWGRGED HCQFVDSHLD GRTGPQSYVE
1860 1870 1880 1890
ALPTIQGYYR QYRQEPVRFG NIGFGTPYYY VGWYECGVSI PGKW
Length:1,894
Mass (Da):205,558
Last modified:June 15, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7A0A9D0445E511D8
GO
Isoform 2 (identifier: Q4ZHG4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-457: EYILSYAPALKPFGAKSLTYPGDTTSALVDGLQPGERYLFKIRATNRRGLGPHSKAFIVAMPTT → A

Show »
Length:1,831
Mass (Da):198,691
Checksum:iF45306BBA0BE0010
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KNQ2J3KNQ2_HUMAN
Fibronectin type III domain-contain...
FNDC1
1,790Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI46784 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAI50608 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAY26234 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAE51894 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti36S → P in AAY26234 (PubMed:9704633).Curated1
Sequence conflicti122P → S in AAI50608 (PubMed:15489334).Curated1
Sequence conflicti1295M → K in CAE51894 (PubMed:16098131).Curated1
Sequence conflicti1487P → S in CAE51894 (PubMed:16098131).Curated1
Sequence conflicti1685D → N in CAE51894 (PubMed:16098131).Curated1
Sequence conflicti1894W → G in CAE51894 (PubMed:16098131).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031826438T → A1 PublicationCorresponds to variant dbSNP:rs509648Ensembl.1
Natural variantiVAR_031827463E → Q2 PublicationsCorresponds to variant dbSNP:rs420137Ensembl.1
Natural variantiVAR_0318281003Q → E2 PublicationsCorresponds to variant dbSNP:rs370434Ensembl.1
Natural variantiVAR_0318291180D → E2 PublicationsCorresponds to variant dbSNP:rs420054Ensembl.1
Natural variantiVAR_0318301261L → P3 PublicationsCorresponds to variant dbSNP:rs3003174Ensembl.1
Natural variantiVAR_0318311280Q → R3 PublicationsCorresponds to variant dbSNP:rs2501176Ensembl.1
Natural variantiVAR_0632251479 – 1484Missing 5 PublicationsCorresponds to variant dbSNP:rs3842694Ensembl.6
Natural variantiVAR_0318321504T → K5 PublicationsCorresponds to variant dbSNP:rs386360Ensembl.1
Natural variantiVAR_0318331574T → A. Corresponds to variant dbSNP:rs7763726Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024663394 – 457EYILS…AMPTT → A in isoform 2. 2 PublicationsAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ009660 mRNA Translation: AAY26234.1 Different initiation.
AL355492 Genomic DNA No translation available.
AL356417 Genomic DNA No translation available.
AL590551 Genomic DNA No translation available.
AB058769 mRNA Translation: BAB47495.2
BC146783 mRNA Translation: AAI46784.1 Different initiation.
BC150607 mRNA Translation: AAI50608.1 Different initiation.
AL832410 mRNA Translation: CAI46178.2
AJ586132 mRNA Translation: CAE51894.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47512.1 [Q4ZHG4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_115921.2, NM_032532.2 [Q4ZHG4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297267; ENSP00000297267; ENSG00000164694 [Q4ZHG4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84624

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84624

UCSC genome browser

More...
UCSCi
uc010kjv.4, human [Q4ZHG4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ009660 mRNA Translation: AAY26234.1 Different initiation.
AL355492 Genomic DNA No translation available.
AL356417 Genomic DNA No translation available.
AL590551 Genomic DNA No translation available.
AB058769 mRNA Translation: BAB47495.2
BC146783 mRNA Translation: AAI46784.1 Different initiation.
BC150607 mRNA Translation: AAI50608.1 Different initiation.
AL832410 mRNA Translation: CAI46178.2
AJ586132 mRNA Translation: CAE51894.1 Frameshift.
CCDSiCCDS47512.1 [Q4ZHG4-1]
RefSeqiNP_115921.2, NM_032532.2 [Q4ZHG4-1]

3D structure databases

SMRiQ4ZHG4
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000297267

PTM databases

GlyGeniQ4ZHG4, 3 sites, 1 O-linked glycan (1 site)
iPTMnetiQ4ZHG4
PhosphoSitePlusiQ4ZHG4

Polymorphism and mutation databases

BioMutaiFNDC1
DMDMi298286926

Proteomic databases

jPOSTiQ4ZHG4
MassIVEiQ4ZHG4
PaxDbiQ4ZHG4
PeptideAtlasiQ4ZHG4
PRIDEiQ4ZHG4
ProteomicsDBi62382 [Q4ZHG4-1]
62383 [Q4ZHG4-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
50561, 40 antibodies

Genome annotation databases

EnsembliENST00000297267; ENSP00000297267; ENSG00000164694 [Q4ZHG4-1]
GeneIDi84624
KEGGihsa:84624
UCSCiuc010kjv.4, human [Q4ZHG4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84624
DisGeNETi84624
EuPathDBiHostDB:ENSG00000164694.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FNDC1
HGNCiHGNC:21184, FNDC1
HPAiENSG00000164694, Tissue enhanced (thyroid)
MIMi609991, gene
neXtProtiNX_Q4ZHG4
OpenTargetsiENSG00000164694
PharmGKBiPA134906656

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4221, Eukaryota
GeneTreeiENSGT00530000063558
HOGENOMiCLU_002998_0_0_1
InParanoidiQ4ZHG4
OMAiWDYKQVS
OrthoDBi46073at2759
PhylomeDBiQ4ZHG4
TreeFamiTF337588

Enzyme and pathway databases

PathwayCommonsiQ4ZHG4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84624, 1 hit in 863 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FNDC1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84624
PharosiQ4ZHG4, Tbio

Protein Ontology

More...
PROi
PR:Q4ZHG4
RNActiQ4ZHG4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164694, Expressed in layer of synovial tissue and 151 other tissues
ExpressionAtlasiQ4ZHG4, baseline and differential
GenevisibleiQ4ZHG4, HS

Family and domain databases

CDDicd00063, FN3, 5 hits
Gene3Di2.60.40.10, 5 hits
InterProiView protein in InterPro
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
PfamiView protein in Pfam
PF00041, fn3, 4 hits
SMARTiView protein in SMART
SM00060, FN3, 5 hits
SUPFAMiSSF49265, SSF49265, 3 hits
PROSITEiView protein in PROSITE
PS50853, FN3, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFNDC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4ZHG4
Secondary accession number(s): A6H8X2
, B7ZBR4, B7ZBR5, B9EK49, Q5JPI0, Q5VU31, Q5VU32, Q5VXX4, Q70CQ6, Q96JG1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: June 15, 2010
Last modified: August 12, 2020
This is version 130 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again