Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 107 (13 Feb 2019)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

FLYWCH-type zinc finger-containing protein 1

Gene

FLYWCH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri116 – 174FLYWCH-type 1Add BLAST59
Zinc fingeri273 – 331FLYWCH-type 2Add BLAST59
Zinc fingeri421 – 479FLYWCH-type 3Add BLAST59
Zinc fingeri509 – 567FLYWCH-type 4Add BLAST59
Zinc fingeri600 – 658FLYWCH-type 5Add BLAST59

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
FLYWCH-type zinc finger-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FLYWCH1
Synonyms:KIAA1552
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000059122.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25404 FLYWCH1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4VC44

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84256

Open Targets

More...
OpenTargetsi
ENSG00000059122

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671760

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FLYWCH1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166217021

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003144601 – 716FLYWCH-type zinc finger-containing protein 1Add BLAST716

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei21PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki134Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei261PhosphoserineCombined sources1
Modified residuei371PhosphoserineCombined sources1
Cross-linki393Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei503PhosphoserineCombined sources1
Modified residuei591PhosphoserineCombined sources1
Cross-linki685Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei696PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q4VC44

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q4VC44

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4VC44

PeptideAtlas

More...
PeptideAtlasi
Q4VC44

PRoteomics IDEntifications database

More...
PRIDEi
Q4VC44

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62302
62303 [Q4VC44-2]
62304 [Q4VC44-3]
62305 [Q4VC44-4]
62306 [Q4VC44-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4VC44

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4VC44

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000059122 Expressed in 197 organ(s), highest expression level in right hemisphere of cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4VC44 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4VC44 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040753
HPA041001

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123983, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q4VC44, 24 interactors

Molecular INTeraction database

More...
MINTi
Q4VC44

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1716
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2RPRNMR-A595-674[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q4VC44

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4VC44

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q4VC44

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi242 – 245Poly-Glu4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri116 – 174FLYWCH-type 1Add BLAST59
Zinc fingeri273 – 331FLYWCH-type 2Add BLAST59
Zinc fingeri421 – 479FLYWCH-type 3Add BLAST59
Zinc fingeri509 – 567FLYWCH-type 4Add BLAST59
Zinc fingeri600 – 658FLYWCH-type 5Add BLAST59

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J2VB Eukaryota
ENOG410YYIU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000064166

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG098123

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4VC44

Identification of Orthologs from Complete Genome Data

More...
OMAi
HALHSCR

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4VC44

TreeFam database of animal gene trees

More...
TreeFami
TF337169

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029279 FLYWCH_N
IPR040312 FWCH1/FWCH2
IPR007588 Znf_FLYWCH

The PANTHER Classification System

More...
PANTHERi
PTHR31665 PTHR31665, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04500 FLYWCH, 5 hits
PF15423 FLYWCH_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4VC44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLPEPSEQE GESVKAGQEP SPKPGTDVIP AAPRKPREFS KLVLLTASDQ
60 70 80 90 100
DEDGVGSKPQ EVHCVLSLEM AGPATLASTL QILPVEEQGG VVQPALEMPE
110 120 130 140 150
QKCSKLDAAA PQSLEFLRTP FGGRLLVLES FLYKQEKAVG DKVYWKCRQH
160 170 180 190 200
AELGCRGRAI TRGLRATVMR GHCHAPDEQG LEARRQREKL PSLALPEGLG
210 220 230 240 250
EPQGPEGPGG RVEEPLEGVG PWQCPEEPEP TPGLVLSKPA LEEEEAPRAL
260 270 280 290 300
SLLSLPPKKR SILGLGQARP LEFLRTCYGG SFLVHESFLY KREKAVGDKV
310 320 330 340 350
YWTCRDHALH GCRSRAITQG QRVTVMRGHC HQPDMEGLEA RRQQEKAVET
360 370 380 390 400
LQAGQDGPGS QVDTLLRGVD SLLYRRGPGP LTLTRPRPRK RAKVEDQELP
410 420 430 440 450
TQPEAPDEHQ DMDADPGGPE FLKTPLGGSF LVYESFLYRR EKAAGEKVYW
460 470 480 490 500
TCRDQARMGC RSRAITQGRR VTVMRGHCHP PDLGGLEALR QREKRPNTAQ
510 520 530 540 550
RGSPGGPEFL KTPLGGSFLV YESFLYRREK AAGEKVYWTC RDQARMGCRS
560 570 580 590 600
RAITQGRRVM VMRRHCHPPD LGGLEALRQR EHFPNLAQWD SPDPLRPLEF
610 620 630 640 650
LRTSLGGRFL VHESFLYRKE KAAGEKVYWM CRDQARLGCR SRAITQGHRI
660 670 680 690 700
MVMRSHCHQP DLAGLEALRQ RERLPTTAQQ EDPEKIQVQL CFKTCSPESQ
710
QIYGDIKDVR LDGESQ
Length:716
Mass (Da):80,108
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBC1DD372CA925A72
GO
Isoform 2 (identifier: Q4VC44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-108: Missing.

Show »
Length:715
Mass (Da):80,037
Checksum:iFF6024A5B29CADBA
GO
Isoform 3 (identifier: Q4VC44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     504-504: P → PGAGLSFQWLFRILQLLGHAPVLLCPSGSSCLPSLPAPHGPCPALSIPLE

Show »
Length:765
Mass (Da):85,153
Checksum:iDF6068B9CB520511
GO
Isoform 4 (identifier: Q4VC44-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-325: Missing.

Show »
Length:391
Mass (Da):44,665
Checksum:iBC4C192159B5CD98
GO
Isoform 5 (identifier: Q4VC44-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-388: Missing.
     389-504: RKRAKVEDQE...RPNTAQRGSP → MPQATSPPLW...ADTASLKAWQ

Show »
Length:328
Mass (Da):36,821
Checksum:i96BE5A7C2B247109
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L231I3L231_HUMAN
FLYWCH-type zinc finger-containing ...
FLYWCH1
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L188I3L188_HUMAN
FLYWCH-type zinc finger-containing ...
FLYWCH1
467Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L0R3I3L0R3_HUMAN
FLYWCH-type zinc finger-containing ...
FLYWCH1
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KNW1J3KNW1_HUMAN
FLYWCH-type zinc finger-containing ...
FLYWCH1
494Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4V9I3L4V9_HUMAN
FLYWCH-type zinc finger-containing ...
FLYWCH1
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L287I3L287_HUMAN
FLYWCH-type zinc finger-containing ...
FLYWCH1
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1A7I3L1A7_HUMAN
FLYWCH-type zinc finger-containing ...
FLYWCH1
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB13378 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti666E → G in AAH28572 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0302771 – 388Missing in isoform 5. 1 PublicationAdd BLAST388
Alternative sequenceiVSP_0302781 – 325Missing in isoform 4. 1 PublicationAdd BLAST325
Alternative sequenceiVSP_030279108Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_030280389 – 504RKRAK…QRGSP → MPQATSPPLWPLSLHGGKGI LWARHSHPPGPPSHHIQDSG RCSLPLPQSPGVTPLPARLS GATPLSPIRLLSSFVPRGPR VIPLTNQARRTLHASLGGCW GRTSDAADTASLKAWQ in isoform 5. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_030281504P → PGAGLSFQWLFRILQLLGHA PVLLCPSGSSCLPSLPAPHG PCPALSIPLE in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB046772 mRNA Translation: BAB13378.1 Different initiation.
AK127235 mRNA Translation: BAC86896.1
CH471112 Genomic DNA Translation: EAW85450.1
CH471112 Genomic DNA Translation: EAW85451.1
BC001973 mRNA Translation: AAH01973.1
BC018712 mRNA Translation: AAH18712.1
BC028572 mRNA Translation: AAH28572.1
AL136585 mRNA Translation: CAB66520.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45390.1 [Q4VC44-2]
CCDS76809.1 [Q4VC44-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001294997.1, NM_001308068.1 [Q4VC44-1]
NP_065963.1, NM_020912.1
NP_115672.2, NM_032296.2 [Q4VC44-2]
XP_006721025.1, XM_006720962.3 [Q4VC44-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655321

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000253928; ENSP00000253928; ENSG00000059122 [Q4VC44-1]
ENST00000416288; ENSP00000399938; ENSG00000059122 [Q4VC44-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84256

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84256

UCSC genome browser

More...
UCSCi
uc002csc.4 human [Q4VC44-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046772 mRNA Translation: BAB13378.1 Different initiation.
AK127235 mRNA Translation: BAC86896.1
CH471112 Genomic DNA Translation: EAW85450.1
CH471112 Genomic DNA Translation: EAW85451.1
BC001973 mRNA Translation: AAH01973.1
BC018712 mRNA Translation: AAH18712.1
BC028572 mRNA Translation: AAH28572.1
AL136585 mRNA Translation: CAB66520.2
CCDSiCCDS45390.1 [Q4VC44-2]
CCDS76809.1 [Q4VC44-1]
RefSeqiNP_001294997.1, NM_001308068.1 [Q4VC44-1]
NP_065963.1, NM_020912.1
NP_115672.2, NM_032296.2 [Q4VC44-2]
XP_006721025.1, XM_006720962.3 [Q4VC44-3]
UniGeneiHs.655321

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2RPRNMR-A595-674[»]
ProteinModelPortaliQ4VC44
SMRiQ4VC44
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123983, 13 interactors
IntActiQ4VC44, 24 interactors
MINTiQ4VC44

PTM databases

iPTMnetiQ4VC44
PhosphoSitePlusiQ4VC44

Polymorphism and mutation databases

BioMutaiFLYWCH1
DMDMi166217021

Proteomic databases

jPOSTiQ4VC44
MaxQBiQ4VC44
PaxDbiQ4VC44
PeptideAtlasiQ4VC44
PRIDEiQ4VC44
ProteomicsDBi62302
62303 [Q4VC44-2]
62304 [Q4VC44-3]
62305 [Q4VC44-4]
62306 [Q4VC44-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000253928; ENSP00000253928; ENSG00000059122 [Q4VC44-1]
ENST00000416288; ENSP00000399938; ENSG00000059122 [Q4VC44-2]
GeneIDi84256
KEGGihsa:84256
UCSCiuc002csc.4 human [Q4VC44-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84256
DisGeNETi84256
EuPathDBiHostDB:ENSG00000059122.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FLYWCH1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0202242
HGNCiHGNC:25404 FLYWCH1
HPAiHPA040753
HPA041001
neXtProtiNX_Q4VC44
OpenTargetsiENSG00000059122
PharmGKBiPA142671760

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J2VB Eukaryota
ENOG410YYIU LUCA
GeneTreeiENSGT00530000064166
HOVERGENiHBG098123
InParanoidiQ4VC44
OMAiHALHSCR
PhylomeDBiQ4VC44
TreeFamiTF337169

Miscellaneous databases

EvolutionaryTraceiQ4VC44

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84256

Protein Ontology

More...
PROi
PR:Q4VC44

Gene expression databases

BgeeiENSG00000059122 Expressed in 197 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiQ4VC44 baseline and differential
GenevisibleiQ4VC44 HS

Family and domain databases

InterProiView protein in InterPro
IPR029279 FLYWCH_N
IPR040312 FWCH1/FWCH2
IPR007588 Znf_FLYWCH
PANTHERiPTHR31665 PTHR31665, 1 hit
PfamiView protein in Pfam
PF04500 FLYWCH, 5 hits
PF15423 FLYWCH_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFWCH1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4VC44
Secondary accession number(s): D3DUA1
, Q6ZSQ1, Q8WV62, Q9BQG6, Q9BUS5, Q9HCM0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: February 13, 2019
This is version 107 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again