Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 114 (17 Jun 2020)
Sequence version 2 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Pleckstrin homology domain-containing family G member 3

Gene

Plekhg3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pleckstrin homology domain-containing family G member 3
Short name:
PH domain-containing family G member 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Plekhg3
Synonyms:Kiaa0599
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2388284 Plekhg3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003068641 – 1341Pleckstrin homology domain-containing family G member 3Add BLAST1341

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei76PhosphoserineBy similarity1
Modified residuei433PhosphoserineCombined sources1
Modified residuei502PhosphoserineCombined sources1
Modified residuei571PhosphoserineCombined sources1
Modified residuei694PhosphoserineBy similarity1
Modified residuei695PhosphoserineBy similarity1
Modified residuei737PhosphoserineCombined sources1
Modified residuei759PhosphoserineBy similarity1
Modified residuei762PhosphoserineCombined sources1
Modified residuei766PhosphoserineCombined sources1
Modified residuei862PhosphoserineBy similarity1
Modified residuei899PhosphoserineCombined sources1
Modified residuei900PhosphoserineCombined sources1
Modified residuei947PhosphoserineBy similarity1
Modified residuei1129PhosphoserineBy similarity1
Modified residuei1134PhosphoserineCombined sources1
Modified residuei1136PhosphoserineCombined sources1
Modified residuei1141PhosphoserineCombined sources1
Modified residuei1155PhosphoserineCombined sources1
Modified residuei1158PhosphoserineCombined sources1
Modified residuei1201PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q4VAC9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4VAC9

PeptideAtlas

More...
PeptideAtlasi
Q4VAC9

PRoteomics IDEntifications database

More...
PRIDEi
Q4VAC9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4VAC9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4VAC9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000052609 Expressed in embryo and 188 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4VAC9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4VAC9 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
234453, 1 interactor

Database of interacting proteins

More...
DIPi
DIP-49616N

Protein interaction database and analysis system

More...
IntActi
Q4VAC9, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000074729

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q4VAC9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4VAC9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini93 – 272DHPROSITE-ProRule annotationAdd BLAST180
Domaini296 – 394PHPROSITE-ProRule annotationAdd BLAST99

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi521 – 710Glu-richAdd BLAST190

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3518 Eukaryota
ENOG410XR81 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156521

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_007600_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4VAC9

KEGG Orthology (KO)

More...
KOi
K23859

Identification of Orthologs from Complete Genome Data

More...
OMAi
SEIVKMW

TreeFam database of animal gene trees

More...
TreeFami
TF328565

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13243 PH_PLEKHG1_G2_G3, 1 hit
cd00160 RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR043324 PH_PLEKHG1_G2_G3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065 SSF48065, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4VAC9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVSTALHQD GSQERPRSLV STTSSSGSSR DSHSAMEEPT GSEASAQNGT
60 70 80 90 100
GSPWDRHVPN SNNNSSGWLN MKGPLSPFNG RAGTSPAYHK LSYLGRVVRE
110 120 130 140 150
IVETERMYVQ DLRSIVEDYL LKIIDTPGLL KPEQVSALFG NIESIYALNS
160 170 180 190 200
QLLRDLDSCN SDPVAVASCF VERSQEFDIY TQYCNNYPNS VAALTECMQD
210 220 230 240 250
KQQAKFFRDR QELLQHSLPL GSYLLKPVQR VLKYHLLLQE IAKHFDEEED
260 270 280 290 300
GFEVVEDAID TMTCVAWYIN DMKRRHEHAV RLQEIQSLLI NWKGPDLTTY
310 320 330 340 350
GELVLEATFR VHRVRNDRTF FLFDKILLIT KKRGDHFVYK GHIPCSSLML
360 370 380 390 400
IESTRDSLCF TVTHYKHSKQ QYSIQAKTVE EKRSWTHHIK RLILENHHAT
410 420 430 440 450
IPQKAKEAIL EMDSYYPSRY RCSPERMKKA WSSQDEVSSH VRQGRRQSEP
460 470 480 490 500
GHTLFSRATL PSRQQGFEMP GLKGRRKSEP TRHLLRQLSE KARAVGMKHA
510 520 530 540 550
GSAGALLDFG QPAHAQKQQP EAERAAREEL EEEEELVEEE EQRQQSFSGS
560 570 580 590 600
LEGLAGHDGS EKVPGPELPG SEEEEEEEES LAVAEQGKRH RESEGSKGCR
610 620 630 640 650
RPSNRSPTSA EKRMSFESVS SLPEVETDPE PGAEQEAFAA LEGPSTEEMP
660 670 680 690 700
SDPEFPEALE TQLHAPKGLL GVDNPAAVVD FVEPEGSEDL KPLSSEEEEE
710 720 730 740 750
EEMEAAQEPE SLLPPSVLDQ ASVIAERFAS SFSRRSSLAI EDGKSSGLGT
760 770 780 790 800
PRLISRSSSV LSLEGSDKGL ARWSSIGDSL SNPPTPEVII GADMVTDNGP
810 820 830 840 850
SVNGTESPSA GSGCPTEQDR SSCKKKESAL STRDRQLLDK IKNYYENAEH
860 870 880 890 900
HDAGFSIRRR ESLSYIPKGL VRSSVSRFNS LPKPDSEPAA PVGYKRPGSS
910 920 930 940 950
RPASWTLFDL PGPRTDKGDP APITDAEFCP SSEIAKIWER MESSERSPRT
960 970 980 990 1000
GSGQSQANGF ELQEPLFILE EHELGAITEE SAVASPESAS PTEQPSPAHL
1010 1020 1030 1040 1050
ARELKELVKE LSSSVQGELV TPLHPRIVQL SHVMDSHVSE RVKNKVYQLA
1060 1070 1080 1090 1100
RQYSLRIKNI KAARPPLQWE KVTPDQEEQV PSISGLPEEA GELSGGKARR
1110 1120 1130 1140 1150
KPVLSLLSYE QLVAQEHGTS KSSAAVETSP RRFSFSPSAV SPRTTSPGAR
1160 1170 1180 1190 1200
SSARSPLSPF DTETFNWPDV RELCSKYTSH DKTAQVESSW PRSLLVNRSR
1210 1220 1230 1240 1250
SLPENIVEPP MSGKADRCCG LNTHRRLGDG EASQPPLPES PPQSQLNGGD
1260 1270 1280 1290 1300
ALYVTADLTL ENNQRVIIME KGPHPSSTVG LEEDSGKESS SPVALKGQGQ
1310 1320 1330 1340
GFQASAEYQP KEHGPRDSAD TNKQGRVRNL REKFQALNSV G
Length:1,341
Mass (Da):148,519
Last modified:July 27, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFFB1EDA92BF6E197
GO
Isoform 2 (identifier: Q4VAC9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     451-480: Missing.
     586-586: Q → QVADFASSLLAALHCWHYRANALLFSRGAM

Show »
Length:1,340
Mass (Da):148,342
Checksum:i2FAEE18DEA48F442
GO
Isoform 3 (identifier: Q4VAC9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     449-627: EPGHTLFSRA...SVSSLPEVET → GEGRAVWTRT...LLREDKNLAL
     628-1341: Missing.

Show »
Length:627
Mass (Da):71,523
Checksum:i93FE3C46E7774424
GO
Isoform 4 (identifier: Q4VAC9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-197: Missing.
     416-431: YPSRYRCSPERMKKAW → CKLPFSACFIPNCVHG
     432-1341: Missing.

Show »
Length:234
Mass (Da):27,678
Checksum:i759B120F0E6270C1
GO
Isoform 5 (identifier: Q4VAC9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-613: Missing.

Show »
Length:728
Mass (Da):78,849
Checksum:i985EBCBF53887230
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2P7L9A0A1W2P7L9_MOUSE
Pleckstrin homology domain-containi...
Plekhg3
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P7Z4A0A1W2P7Z4_MOUSE
Pleckstrin homology domain-containi...
Plekhg3
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P798A0A1W2P798_MOUSE
Pleckstrin homology domain-containi...
Plekhg3
9Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAE36687 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti203Q → K in BAE36687 (PubMed:16141072).Curated1
Sequence conflicti216H → Q in BAE36687 (PubMed:16141072).Curated1
Sequence conflicti580 – 585SLAVAE → ADFCLL in BAD32255 (PubMed:15368895).Curated6
Sequence conflicti929C → R in AAH96443 (PubMed:15489334).Curated1
Sequence conflicti929C → R in AAH31136 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0285351 – 613Missing in isoform 5. 1 PublicationAdd BLAST613
Alternative sequenceiVSP_0285361 – 197Missing in isoform 4. 1 PublicationAdd BLAST197
Alternative sequenceiVSP_028537416 – 431YPSRY…MKKAW → CKLPFSACFIPNCVHG in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_028538432 – 1341Missing in isoform 4. 1 PublicationAdd BLAST910
Alternative sequenceiVSP_028539449 – 627EPGHT…PEVET → GEGRAVWTRTFFLGSLAQAG IICSDIVGRWSLQKAGEDSR VGWWMSVDRFLFMPGFPSNN HLLCLLLTRAVHLLKGLGMF VIQDLASLLSHLNLLALLLS QSSTWKSWDSFSVQVSSDSR GWVGGKTLRPSGTKSRQEIF ILGHAIFLSWVFFHDGICLC ARGVIRMKRLLREDKNLAL in isoform 3. 1 PublicationAdd BLAST179
Alternative sequenceiVSP_028540451 – 480Missing in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_028541586Q → QVADFASSLLAALHCWHYRA NALLFSRGAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_028542628 – 1341Missing in isoform 3. 1 PublicationAdd BLAST714

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK080928 mRNA Translation: BAC38083.1
AK162025 mRNA Translation: BAE36687.1 Different initiation.
AC163033 Genomic DNA No translation available.
BC030417 mRNA Translation: AAH30417.1
BC031136 mRNA Translation: AAH31136.1
BC049264 mRNA Translation: AAH49264.1
BC096443 mRNA Translation: AAH96443.1
AK172977 mRNA Translation: BAD32255.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25994.1 [Q4VAC9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_722499.4, NM_153804.4 [Q4VAC9-1]
XP_006515938.1, XM_006515875.3 [Q4VAC9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000075249; ENSMUSP00000074729; ENSMUSG00000052609 [Q4VAC9-1]
ENSMUST00000219063; ENSMUSP00000151851; ENSMUSG00000052609 [Q4VAC9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
263406

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:263406

UCSC genome browser

More...
UCSCi
uc007nyi.2 mouse [Q4VAC9-3]
uc007nyj.2 mouse [Q4VAC9-2]
uc007nyk.2 mouse [Q4VAC9-1]
uc029rtp.1 mouse [Q4VAC9-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK080928 mRNA Translation: BAC38083.1
AK162025 mRNA Translation: BAE36687.1 Different initiation.
AC163033 Genomic DNA No translation available.
BC030417 mRNA Translation: AAH30417.1
BC031136 mRNA Translation: AAH31136.1
BC049264 mRNA Translation: AAH49264.1
BC096443 mRNA Translation: AAH96443.1
AK172977 mRNA Translation: BAD32255.1
CCDSiCCDS25994.1 [Q4VAC9-1]
RefSeqiNP_722499.4, NM_153804.4 [Q4VAC9-1]
XP_006515938.1, XM_006515875.3 [Q4VAC9-2]

3D structure databases

SMRiQ4VAC9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi234453, 1 interactor
DIPiDIP-49616N
IntActiQ4VAC9, 2 interactors
STRINGi10090.ENSMUSP00000074729

PTM databases

iPTMnetiQ4VAC9
PhosphoSitePlusiQ4VAC9

Proteomic databases

jPOSTiQ4VAC9
PaxDbiQ4VAC9
PeptideAtlasiQ4VAC9
PRIDEiQ4VAC9

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
57155 78 antibodies

Genome annotation databases

EnsembliENSMUST00000075249; ENSMUSP00000074729; ENSMUSG00000052609 [Q4VAC9-1]
ENSMUST00000219063; ENSMUSP00000151851; ENSMUSG00000052609 [Q4VAC9-2]
GeneIDi263406
KEGGimmu:263406
UCSCiuc007nyi.2 mouse [Q4VAC9-3]
uc007nyj.2 mouse [Q4VAC9-2]
uc007nyk.2 mouse [Q4VAC9-1]
uc029rtp.1 mouse [Q4VAC9-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26030
MGIiMGI:2388284 Plekhg3

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3518 Eukaryota
ENOG410XR81 LUCA
GeneTreeiENSGT00940000156521
HOGENOMiCLU_007600_0_0_1
InParanoidiQ4VAC9
KOiK23859
OMAiSEIVKMW
TreeFamiTF328565

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
263406 1 hit in 12 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Plekhg3 mouse

Protein Ontology

More...
PROi
PR:Q4VAC9
RNActiQ4VAC9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000052609 Expressed in embryo and 188 other tissues
ExpressionAtlasiQ4VAC9 baseline and differential
GenevisibleiQ4VAC9 MM

Family and domain databases

CDDicd13243 PH_PLEKHG1_G2_G3, 1 hit
cd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR043324 PH_PLEKHG1_G2_G3
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPKHG3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4VAC9
Secondary accession number(s): E9QL46
, Q3TSI8, Q6A041, Q8BJP5, Q8K0L5, Q8K0T6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: July 27, 2011
Last modified: June 17, 2020
This is version 114 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again