Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (02 Jun 2021)
Sequence version 1 (05 Jul 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Xin actin-binding repeat-containing protein 2

Gene

Xirp2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protects actin filaments from depolymerization.

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Xin actin-binding repeat-containing protein 2
Alternative name(s):
Beta-xin
Cardiomyopathy-associated protein 3
Myogenic MEF2-activated Xin-related protein
Myomaxin
mXinbeta
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Xirp2
Synonyms:Cmya3, Xin2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2685198, Xirp2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003169881 – 3784Xin actin-binding repeat-containing protein 2Add BLAST3784

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei123PhosphoserineCombined sources1
Modified residuei567PhosphoserineBy similarity1
Modified residuei635PhosphoserineBy similarity1
Modified residuei815PhosphoserineCombined sources1
Modified residuei1212PhosphoserineBy similarity1
Modified residuei1576PhosphoserineBy similarity1
Modified residuei2139PhosphoserineCombined sources1
Modified residuei2192PhosphoserineBy similarity1
Modified residuei2974PhosphoserineCombined sources1
Modified residuei3206PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q4U4S6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4U4S6

PRoteomics IDEntifications database

More...
PRIDEi
Q4U4S6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
299706 [Q4U4S6-1]
299707 [Q4U4S6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4U4S6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4U4S6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expression is restricted to heart and skeletal muscle. Present in intercalated disks of the heart and in the Z-disk region of skeletal muscle (at protein level).2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By MEF2A in skeletal muscle. By angiotensin II in heart.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000027022, Expressed in hindlimb stylopod muscle and 30 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4U4S6, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ACTN2.

Interacts with F-actin (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
232312, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q4U4S6, 4 interactors

Molecular INTeraction database

More...
MINTi
Q4U4S6

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000107966

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q4U4S6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4U4S6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati308 – 323Xin 1Add BLAST16
Repeati343 – 358Xin 2Add BLAST16
Repeati383 – 398Xin 3Add BLAST16
Repeati420 – 435Xin 4Add BLAST16
Repeati458 – 473Xin 5Add BLAST16
Repeati498 – 513Xin 6Add BLAST16
Repeati536 – 551Xin 7Add BLAST16
Repeati574 – 589Xin 8Add BLAST16
Repeati608 – 623Xin 9Add BLAST16
Repeati642 – 657Xin 10Add BLAST16
Repeati679 – 694Xin 11Add BLAST16
Repeati715 – 730Xin 12Add BLAST16
Repeati746 – 761Xin 13Add BLAST16
Repeati784 – 799Xin 14Add BLAST16
Repeati822 – 837Xin 15Add BLAST16
Repeati861 – 876Xin 16Add BLAST16
Repeati894 – 909Xin 17Add BLAST16
Repeati932 – 947Xin 18Add BLAST16
Repeati967 – 982Xin 19Add BLAST16
Repeati1006 – 1021Xin 20Add BLAST16
Repeati1042 – 1057Xin 21Add BLAST16
Repeati1079 – 1094Xin 22Add BLAST16
Repeati1117 – 1132Xin 23Add BLAST16
Repeati1154 – 1169Xin 24Add BLAST16
Repeati1188 – 1203Xin 25Add BLAST16
Repeati1219 – 1234Xin 26Add BLAST16
Repeati1256 – 1271Xin 27Add BLAST16
Repeati1291 – 1306Xin 28Add BLAST16
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3255 – 3315LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST61

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni173 – 234DisorderedSequence analysisAdd BLAST62
Regioni1864 – 1889DisorderedSequence analysisAdd BLAST26
Regioni1963 – 1982DisorderedSequence analysisAdd BLAST20
Regioni2018 – 2124DisorderedSequence analysisAdd BLAST107
Regioni2152 – 2190DisorderedSequence analysisAdd BLAST39
Regioni2203 – 2279DisorderedSequence analysisAdd BLAST77
Regioni2293 – 2354DisorderedSequence analysisAdd BLAST62
Regioni2461 – 2489DisorderedSequence analysisAdd BLAST29
Regioni2551 – 2573DisorderedSequence analysisAdd BLAST23
Regioni2640 – 2676DisorderedSequence analysisAdd BLAST37
Regioni2801 – 2922DisorderedSequence analysisAdd BLAST122
Regioni3478 – 3518DisorderedSequence analysisAdd BLAST41
Regioni3536 – 3561DisorderedSequence analysisAdd BLAST26

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili2285 – 2333Sequence analysisAdd BLAST49
Coiled coili2683 – 2711Sequence analysisAdd BLAST29
Coiled coili2739 – 2767Sequence analysisAdd BLAST29
Coiled coili3043 – 3075Sequence analysisAdd BLAST33

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi174 – 215Polar residuesSequence analysisAdd BLAST42
Compositional biasi1864 – 1882Basic and acidic residuesSequence analysisAdd BLAST19
Compositional biasi2031 – 2064Pro residuesSequence analysisAdd BLAST34
Compositional biasi2067 – 2084Polar residuesSequence analysisAdd BLAST18
Compositional biasi2105 – 2119Pro residuesSequence analysisAdd BLAST15
Compositional biasi2203 – 2224Basic and acidic residuesSequence analysisAdd BLAST22
Compositional biasi2260 – 2276Polar residuesSequence analysisAdd BLAST17
Compositional biasi2293 – 2308Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi2318 – 2352Basic and acidic residuesSequence analysisAdd BLAST35
Compositional biasi2464 – 2489Basic and acidic residuesSequence analysisAdd BLAST26
Compositional biasi2643 – 2671Polar residuesSequence analysisAdd BLAST29
Compositional biasi2809 – 2824Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi2859 – 2889Polar residuesSequence analysisAdd BLAST31
Compositional biasi3547 – 3561Polar residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Xin repeats bind F-actin.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Xin family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502SF50, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063779

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000319_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4U4S6

Identification of Orthologs from Complete Genome Data

More...
OMAi
PPLMMLP

Database of Orthologous Groups

More...
OrthoDBi
30028at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4U4S6

TreeFam database of animal gene trees

More...
TreeFami
TF330745

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012510, Actin-binding_Xin_repeat
IPR030072, XIRP1/XIRP2
IPR030107, XIRP2
IPR001781, Znf_LIM

The PANTHER Classification System

More...
PANTHERi
PTHR22591, PTHR22591, 1 hit
PTHR22591:SF1, PTHR22591:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00412, LIM, 1 hit
PF08043, Xin, 20 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132, LIM, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00478, LIM_DOMAIN_1, 1 hit
PS50023, LIM_DOMAIN_2, 1 hit
PS51389, XIN, 28 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4U4S6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARYQAAVSR GDTRSFSANV MEESDVCTVP GGLAKMKRQF EKDKMTSTCN
60 70 80 90 100
AFSEYQYRHE SRAEQEAIHS SQEIIRRNEQ EVSKGHGTDV FKAEMMSHLE
110 120 130 140 150
KHTEETKQAS QFHQYVQETV IDSPEEEELP KVSTKILKEQ FEKSAQENFL
160 170 180 190 200
RSDKETSPPA KCMKIENDIE ETLKPSSAVG TSSSYTSTRQ RKETSTSSYS
210 220 230 240 250
NHSLTSTTLA QDNGTPSGKM EEFPPPPPDV CQTPMDVTAF SQSPEFPSPP
260 270 280 290 300
RRLPMPKDLY SKQRNLYELN RLYRHIHPEL RKNLEKDYIS EVSEIVSSQI
310 320 330 340 350
NSGNALSADV QKARYVFENT NDSSQKDLNS ERENLEWDEI LKGEVQSIRW
360 370 380 390 400
IFENQPLDSI NHGSTDEGYT SKGIADQELI AGSDVKYTTW MFETQPIDAL
410 420 430 440 450
GIPSAGTEGN TEKIPELARG DVYTARWMFE TRPLDSMNKM HECQEETAST
460 470 480 490 500
LTKDITGGDV KTVRYMFETQ QLDQLGQLHS VDELNLLQLR SELKEIKGNV
510 520 530 540 550
KRSIKCFETQ PLYVIRDGSG QMLEIKTVQR EDIEKGDVRT ARWMFETQPL
560 570 580 590 600
DTINKDITEI KVVRGISMEE NVKGGVSRAK WLFETQPLEK IKEESGEAVL
610 620 630 640 650
KTEAVIGTDV SKKCWMFETQ PLDILKDSPD TDSVSPEERI GGDVKTTKHL
660 670 680 690 700
FETLPIEALK DSPDIGKLQK ITASEEEKGD VKHQKWVFET QRLEDIREDK
710 720 730 740 750
KEYTRTVRLE AVDRGHVKNY THIFESNNLI KVDASHQIEV EGVTRGTVEL
760 770 780 790 800
NKSLFETTPL YAIQDHLGKY HQVKTVQQEE IVRGDVRSCR WLFETRPIDQ
810 820 830 840 850
FDESLHKFQI IRGISAQEIQ AGNVKSARWL FETQPLDSIK YFSNVEETDS
860 870 880 890 900
KTEQSTDIVK GDVKTCKWLF ETQPMESLYE KASLMTNSED IHKGDVRTCM
910 920 930 940 950
WLFETQPLDA IKDDSEATVK LQTVKQEEIQ GGDVQTACFL FETENLDNIQ
960 970 980 990 1000
GDEGKENKPL EMDIQSGDVS GMKFKFENQS LDSINCSSEN VLSKIKTLKA
1010 1020 1030 1040 1050
EDIQKGNVLK CRWLFENQPI DMIKESQECD GLVKTVTDVQ GGDVRKGCFI
1060 1070 1080 1090 1100
FETFSLDEIK DESDGISMRE TNLGEIIKGD VKSYKMLFET QPLYAIQDHE
1110 1120 1130 1140 1150
GFYHEVTTVK KEETIHGDVR GTRWLFETKP LDSIHESEDV YVIKSVTQED
1160 1170 1180 1190 1200
IQKGDVSSVR YRFETQPLDM ISDKSHNIVP TVDYIQGGNV QMNKQLFESE
1210 1220 1230 1240 1250
GGNKKNYVRT VSVNEIQKGN VKTSTWLFET HRIDELGEES RYENIKTVTQ
1260 1270 1280 1290 1300
EDVQKGDVKQ AVWLFENQTL DSINELDEND TKMTKEEIPP SDVKTTTWLF
1310 1320 1330 1340 1350
ETTPIHEFNK TRVEKEEIIG KSIKETLEDL YSQRVVEAPG IIIEADEVGD
1360 1370 1380 1390 1400
VRMAKYKLMN QTTPEIQKEE VIRADLGNIM MNLLSQRDCT KKEIFVSEEE
1410 1420 1430 1440 1450
KGNVNFTKTQ LLNRSMEFHA EKEEIVRGDV KQAIQKLFSE ERRAKKGILI
1460 1470 1480 1490 1500
QEDEKGDINM TIYCLLHENA GDKTEREDIL GGDVRRTIHN LLSSASNGKI
1510 1520 1530 1540 1550
SERTKIDASE RGNVQFFTTC IETGALDYLK QLQTGSNEST LTASKQEGEE
1560 1570 1580 1590 1600
EIIGGDVEGT KFLLKKRQSS FERTVSETDI IPGDVRHTVK VFMTEPQSSS
1610 1620 1630 1640 1650
YKTVKDEIIK GDLKSTLNSL NQAMNQKTVA KAEEIVKDDR LAILKSLKES
1660 1670 1680 1690 1700
GDRQKEPKQS GGMSRDIGQA IECLERATNT RTEILKKELI LDDLKTSLRS
1710 1720 1730 1740 1750
LKEEQCGFKE VDKQGIVKDV LPGMLGFSER PKIGIHPAAV QRDKKSLLQP
1760 1770 1780 1790 1800
VPGPFEPAIK QQAGPGTLDE TTQKPCLRSL IEERTEANLP KAPKGTVKIV
1810 1820 1830 1840 1850
IDREQNNDAL EKSLRKMSNS EHRAMKNVLD MSDRMGIWTE SKEYLCSDDH
1860 1870 1880 1890 1900
MSKHLSATMS IKESLKSKES ENMREAKDDV ISSTQSVDKT FRKQQTQTCE
1910 1920 1930 1940 1950
LGNDQKSRFQ DSYGKNQKNI QNIEITRDFQ KQALLSQEKQ YSNKEMKKNE
1960 1970 1980 1990 2000
ASLQPLPVGK EVHSVPGVTV SGKNHKRIQA TDKRQKTDVC LESQDFLMKT
2010 2020 2030 2040 2050
NTSKELKMAM ERSFNPINLH PECGIKENED SLPPPSPPPL PPSNASSEIE
2060 2070 2080 2090 2100
FPLPPPPPLM LLPGKNESPP SSPTEKTRTE FESLSTLPLP PPPVDEKAEQ
2110 2120 2130 2140 2150
ECLSTTLPPP PPPTPCQPGH LLPSSVLGHH REAFLQQFSQ KEALGVHLPH
2160 2170 2180 2190 2200
SQAKILTGKS PPPTLPKPKL PKRIKDKMNQ YSSSGELERS LSDVEIKATL
2210 2220 2230 2240 2250
SKDQKRSMVT MSSEHRETKQ DVFGKGLVGR KQLPVDSANS LSQTVPEIPA
2260 2270 2280 2290 2300
PKEKQTAPLV KSHSFPSGSE QQSPKPYMRK FKTPLMIAEE KYRQQREELE
2310 2320 2330 2340 2350
KQRQESSSHN VIKTETQHQS LSEKEEEIEL QKATEAISTP RKESDFPRAR
2360 2370 2380 2390 2400
PNLDSESRAV IAGECSESQL ATASTLTVAT ERLQHVLAAS EDELTLRQEG
2410 2420 2430 2440 2450
IQNSSDASQS KLACETSQSH KECKAQQTFE QHVKRLPFPQ TKPSSPSFKV
2460 2470 2480 2490 2500
KTIKLSTLDH TGTETDLSSK HHTKQSEVDI QTSTEQTDKE IKKTQASIQC
2510 2520 2530 2540 2550
DDKPSVPEKY FQLPKTEKRV TIQMPKEYAE KSHKSKLQTV PKKQGIFGEF
2560 2570 2580 2590 2600
DRGNVLGREG KNQDSSVSCS KEDRLIDERK QEHLQNQRVP RSVQQKVINE
2610 2620 2630 2640 2650
RLDSQMQNFQ QTEIQTSRST IECEEFSQSY NATQEKTCLK DKGKQQGQVT
2660 2670 2680 2690 2700
SNTEESKQEL RQNQSAFSSV KDSQHDDGKC TINILEFLRK REELQQILSR
2710 2720 2730 2740 2750
VKQFEAESSK SGLKTFQILL NIVPVWLISE EKREYGVRVA MENNFEKVKE
2760 2770 2780 2790 2800
EITHIKTQAE EMLLQCEHVI QTAMMASQTG KQRDKPTNLN EMPLNVSNVN
2810 2820 2830 2840 2850
LSSSKCTEQK ESKTVEEKLT HRQVTTHPEA ATRNPVKPYQ EAKGEDGKMA
2860 2870 2880 2890 2900
PPSLKTRPPS PTFITIESTA RRAETSTKSE LSQSPKNNRC IEPPPRRPVE
2910 2920 2930 2940 2950
HASGLPRSRT PPSPPRSRSE QLVRLKDTTA RLAKGTIPCS PGTPVPIVEK
2960 2970 2980 2990 3000
RSEVVMSPAT LRRQIKIESR GGDSPPTITI PVSVNHVVSG SFRESVDAQE
3010 3020 3030 3040 3050
AVKKTEKTET YVHKDKMNSV NRAMPETESY DAVEIIRKVE GPHLSEHTER
3060 3070 3080 3090 3100
FEATNQTVQR AERFLNGHEN EINRWFREFE NDPVFRAKTE RGAYANGEIN
3110 3120 3130 3140 3150
HNMKQESHTF CKEEFGLASS ETANFTGFSY RHPKVPAMQP RVHSEARSLN
3160 3170 3180 3190 3200
EHFSSVDAFD SQIVGSKVAT SSSRSTEAGR SGFDFKHAPP TYEDVISGHI
3210 3220 3230 3240 3250
LDVADSPTNL RRNFQKTWQE SERVFQRVGY ETSDAHATEM SRAFQEESAF
3260 3270 3280 3290 3300
LSDKEICIIC QKTVYPMECL IADKQNFHKS CFRCHHCSSK LSLGNYASLH
3310 3320 3330 3340 3350
GRIYCKPHFK QLFKSKGNYD EGFGHKQHKD RWNCKNQSSL VDFIPSGEPD
3360 3370 3380 3390 3400
AHENPTADTL LLGDLTTHPD ACNSKRQDND LRKWGDRGKL KIVWPPCQEM
3410 3420 3430 3440 3450
PKKNSPPEEE FKVNKAKWPP EVTIPVPSDF KRESLTEHVK TLESQGQEQD
3460 3470 3480 3490 3500
SVPDLQPCKH VCQKEDITGI KEIKGYEERK DEKEAKDTLK DAEGLRSKRK
3510 3520 3530 3540 3550
SGMEFNDHNA HAQSDGKEKN ALVNEADSAD VLQVANTDDE GGPENHRENF
3560 3570 3580 3590 3600
NNNNNNSVAV SSLNNGRQKI SISERPRLLQ AVSEANYYTS EYQIKNFNNA
3610 3620 3630 3640 3650
SKISELLGIF ESQKLSSKKV LALALERTAD RGTAGSPLQL VLEPGLQQGF
3660 3670 3680 3690 3700
SVKGENLAAS PDVSPLHIKG NHENNKNVHL FFSNTVKITS FSKKHNILGC
3710 3720 3730 3740 3750
DLMDSVDQLK NMSCLYLREL GKNVKCWHGE TAGAARHGGK MCFDAQSQGS
3760 3770 3780
AAKPVFPSMQ CQAQHLTVEE QIKRDRCYSD SEAD
Length:3,784
Mass (Da):428,259
Last modified:July 5, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC95FD2E0AD5CEBBC
GO
Isoform 2 (identifier: Q4U4S6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3253-3551: DKEICIICQK...GPENHRENFN → ETVGPRQGNLHNLSKDSLSNGVPHSRQAEFS
     3552-3784: Missing.

Show »
Length:3,283
Mass (Da):371,929
Checksum:i1AFEC6DE2CB999D1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A5F8MPR4A0A5F8MPR4_MOUSE
Xin actin-binding repeat-containing...
Xirp2
3,512Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MP54A0A5F8MP54_MOUSE
Xin actin-binding repeat-containing...
Xirp2
284Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B2BBR6B2BBR6_MOUSE
Xeplin variant 1
Xirp2 Cmya3
701Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MPJ5A0A5F8MPJ5_MOUSE
Xin actin-binding repeat-containing...
Xirp2
930Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MQC2A0A5F8MQC2_MOUSE
Xin actin-binding repeat-containing...
Xirp2
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti44K → E in AAV52766 (PubMed:17766470).Curated1
Sequence conflicti721T → A in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti837D → G in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti1633E → G in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2114T → A in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2179N → S in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2408S → P in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2457T → A in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2784D → G in ABL63748 (PubMed:17046827).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0308493253 – 3551DKEIC…RENFN → ETVGPRQGNLHNLSKDSLSN GVPHSRQAEFS in isoform 2. 2 PublicationsAdd BLAST299
Alternative sequenceiVSP_0308503552 – 3784Missing in isoform 2. 2 PublicationsAdd BLAST233

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
EF122140 mRNA Translation: ABL63748.1
DQ011666 mRNA Translation: AAY44537.1
EF119716 mRNA Translation: ABO69252.1
AL929411 Genomic DNA No translation available.
AY775570 mRNA Translation: AAV52766.1
AY775571 mRNA Translation: AAV52767.1
AY775572 mRNA Translation: AAV52768.1
AK040786 mRNA Translation: BAC30703.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16082.1 [Q4U4S6-1]
CCDS38133.1 [Q4U4S6-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001019789.1, NM_001024618.2 [Q4U4S6-1]
NP_001077388.1, NM_001083919.1 [Q4U4S6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000028410; ENSMUSP00000028410; ENSMUSG00000027022 [Q4U4S6-1]
ENSMUST00000112347; ENSMUSP00000107966; ENSMUSG00000027022 [Q4U4S6-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
241431

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:241431

UCSC genome browser

More...
UCSCi
uc008jxj.1, mouse [Q4U4S6-2]
uc008jxk.1, mouse [Q4U4S6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF122140 mRNA Translation: ABL63748.1
DQ011666 mRNA Translation: AAY44537.1
EF119716 mRNA Translation: ABO69252.1
AL929411 Genomic DNA No translation available.
AY775570 mRNA Translation: AAV52766.1
AY775571 mRNA Translation: AAV52767.1
AY775572 mRNA Translation: AAV52768.1
AK040786 mRNA Translation: BAC30703.1
CCDSiCCDS16082.1 [Q4U4S6-1]
CCDS38133.1 [Q4U4S6-2]
RefSeqiNP_001019789.1, NM_001024618.2 [Q4U4S6-1]
NP_001077388.1, NM_001083919.1 [Q4U4S6-2]

3D structure databases

SMRiQ4U4S6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi232312, 11 interactors
IntActiQ4U4S6, 4 interactors
MINTiQ4U4S6
STRINGi10090.ENSMUSP00000107966

PTM databases

iPTMnetiQ4U4S6
PhosphoSitePlusiQ4U4S6

Proteomic databases

jPOSTiQ4U4S6
PaxDbiQ4U4S6
PRIDEiQ4U4S6
ProteomicsDBi299706 [Q4U4S6-1]
299707 [Q4U4S6-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33785, 48 antibodies

Genome annotation databases

EnsembliENSMUST00000028410; ENSMUSP00000028410; ENSMUSG00000027022 [Q4U4S6-1]
ENSMUST00000112347; ENSMUSP00000107966; ENSMUSG00000027022 [Q4U4S6-2]
GeneIDi241431
KEGGimmu:241431
UCSCiuc008jxj.1, mouse [Q4U4S6-2]
uc008jxk.1, mouse [Q4U4S6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
129446
MGIiMGI:2685198, Xirp2

Phylogenomic databases

eggNOGiENOG502SF50, Eukaryota
GeneTreeiENSGT00530000063779
HOGENOMiCLU_000319_0_0_1
InParanoidiQ4U4S6
OMAiPPLMMLP
OrthoDBi30028at2759
PhylomeDBiQ4U4S6
TreeFamiTF330745

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
241431, 0 hits in 52 CRISPR screens

Protein Ontology

More...
PROi
PR:Q4U4S6
RNActiQ4U4S6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000027022, Expressed in hindlimb stylopod muscle and 30 other tissues
ExpressionAtlasiQ4U4S6, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR012510, Actin-binding_Xin_repeat
IPR030072, XIRP1/XIRP2
IPR030107, XIRP2
IPR001781, Znf_LIM
PANTHERiPTHR22591, PTHR22591, 1 hit
PTHR22591:SF1, PTHR22591:SF1, 1 hit
PfamiView protein in Pfam
PF00412, LIM, 1 hit
PF08043, Xin, 20 hits
SMARTiView protein in SMART
SM00132, LIM, 1 hit
PROSITEiView protein in PROSITE
PS00478, LIM_DOMAIN_1, 1 hit
PS50023, LIM_DOMAIN_2, 1 hit
PS51389, XIN, 28 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiXIRP2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4U4S6
Secondary accession number(s): A1ECA5
, A2AVA2, Q5S4P6, Q5S4P7, Q5S4P8, Q8BS23
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: July 5, 2005
Last modified: June 2, 2021
This is version 110 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again