Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (12 Aug 2020)
Sequence version 1 (19 Jul 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Endothelin-converting enzyme 1

Gene

Ece1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts big endothelin-1 to endothelin-1.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolysis of the 21-Trp-|-Val-22 bond in big endothelin to form endothelin 1. EC:3.4.24.71

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by phosphoramidon.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi606Zinc; catalyticPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei607PROSITE-ProRule annotation1
Metal bindingi610Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi666Zinc; catalyticPROSITE-ProRule annotation1
Active sitei670Proton donorPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-375276, Peptide ligand-binding receptors

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M13.002

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Endothelin-converting enzyme 1 (EC:3.4.24.71)
Short name:
ECE-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ece1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1101357, Ece1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 67CytoplasmicSequence analysisAdd BLAST67
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei68 – 88Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini89 – 769ExtracellularSequence analysisAdd BLAST681

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002406291 – 769Endothelin-converting enzyme 1Add BLAST769

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24PhosphothreonineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi98 ↔ 103PROSITE-ProRule annotation
Disulfide bondi121 ↔ 754PROSITE-ProRule annotation
Disulfide bondi129 ↔ 714PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi165N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi184 ↔ 434PROSITE-ProRule annotation
Glycosylationi186N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi209N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi269N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi315N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi361N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi382N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi538N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi631N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi643 ↔ 766PROSITE-ProRule annotation
Glycosylationi650N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q4PZA2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4PZA2

PeptideAtlas

More...
PeptideAtlasi
Q4PZA2

PRoteomics IDEntifications database

More...
PRIDEi
Q4PZA2

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2289, 3 N-Linked glycans (3 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q4PZA2, 10 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4PZA2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4PZA2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q4PZA2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000057530, Expressed in aortic valve and 309 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4PZA2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4PZA2, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked (By similarity).

Interacts with PPP1R16B (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
231041, 3 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000099576

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q4PZA2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4PZA2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini97 – 769Peptidase M13PROSITE-ProRule annotationAdd BLAST673

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M13 family.PROSITE-ProRule annotationCurated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3624, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156050

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006187_8_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4PZA2

KEGG Orthology (KO)

More...
KOi
K01415

Identification of Orthologs from Complete Genome Data

More...
OMAi
DQRFFMN

Database of Orthologous Groups

More...
OrthoDBi
282463at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4PZA2

TreeFam database of animal gene trees

More...
TreeFami
TF315192

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08662, M13, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1380.10, 1 hit
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029734, ECE1
IPR024079, MetalloPept_cat_dom_sf
IPR000718, Peptidase_M13
IPR018497, Peptidase_M13_C
IPR042089, Peptidase_M13_dom_2
IPR008753, Peptidase_M13_N

The PANTHER Classification System

More...
PANTHERi
PTHR11733, PTHR11733, 1 hit
PTHR11733:SF130, PTHR11733:SF130, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01431, Peptidase_M13, 1 hit
PF05649, Peptidase_M13_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00786, NEPRILYSIN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51885, NEPRILYSIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: Q4PZA2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRTVWSPLAA ALAALGMSTY KRATLDEEDL VDSLSEGDVY PNGLQVNFRS
60 70 80 90 100
SRSGQRCWAA RTSVEKRLVV LVTLLAAGLV ACLAALGIQY QTRTPPVCLT
110 120 130 140 150
EACVSVTSSI LNSMDPTVDP CQDFFSYACG GWIKANPVPD GHSRWGTFSN
160 170 180 190 200
LWEHNQAVIK HLLENATASV SEAERKAQVY YRACMNETRI EELRAKPLME
210 220 230 240 250
LIEKLGGWNI TGPWAKDNFQ DTLQVVTAHY RTSPFFSVYV SADSKNSNSN
260 270 280 290 300
VIQVDQSGLG LPSRDYYLNK TENEKVLTGY LNYMVQLGKL LGGGDEDAIR
310 320 330 340 350
PQMQQILDFE TALANITIPQ EKRRDEELIY HKVTAAELQT LAPAINWLPF
360 370 380 390 400
LNTIFYPVEI NESEPIVVYD KEYLRQVSTL INNTDKCLLN NYMMWNLVRK
410 420 430 440 450
TSSFLDQRFQ DADEKFMEVM YGTKKTCIPR WKFCVSDTEN NLGFALGPMF
460 470 480 490 500
VKATFAEDSK NIASEIIMEI KKAFEESLST LKWMDEETRR SAKEKADAIY
510 520 530 540 550
NMIGYPNFIM DPKELDKVFN DYTAVPDLYF ENAMRFFNFS WRVTADQLRK
560 570 580 590 600
APNRDQWSMT PPMVNAYYSP TKNEIVFPAG ILQAPFYTRS SPNALNFGGI
610 620 630 640 650
GVVVGHELTH AFDDQGREYD KDGNLRPWWK NSSVEAFKQQ TECMVQQYSN
660 670 680 690 700
YSVNGEPVNG RHTLGENIAD NGGLKAAYRA YQNWVKKNGA EQTLPTLGLT
710 720 730 740 750
SNQLFFLGFA QVWCSVRTPE SSHEGLITDP HSPSRFRVIG SLSNSKEFSE
760
HFRCPPGSPM NPHHKCEVW
Length:769
Mass (Da):87,073
Last modified:July 19, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i58214938A0F2760A
GO
Isoform A (identifier: Q4PZA2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRTVWSPLAAALAALGMSTYKRATLDEEDLVDSLSEGDVYPNG → MPPQSLGLQRGSFFLGKRGPGLMVSLPLLASS

Show »
Length:758
Mass (Da):85,800
Checksum:i0CC66DD2DEAE206D
GO
Isoform C (identifier: Q4PZA2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:753
Mass (Da):85,463
Checksum:iAEEF9C11ABB6657C
GO
Isoform D (identifier: Q4PZA2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MRTVWSPLAAALAALG → METLRESVLHLALQ

Show »
Length:767
Mass (Da):87,085
Checksum:i54118EC09E36D032
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AXF8B1AXF8_MOUSE
Endothelin-converting enzyme 1
Ece1
205Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CZB7E0CZB7_MOUSE
Endothelin-converting enzyme 1
Ece1
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0193991 – 43MRTVW…VYPNG → MPPQSLGLQRGSFFLGKRGP GLMVSLPLLASS in isoform A. CuratedAdd BLAST43
Alternative sequenceiVSP_0194001 – 16Missing in isoform C. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_0194011 – 16MRTVW…LAALG → METLRESVLHLALQ in isoform D. CuratedAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ022741 DQ022729 Genomic DNA Translation: AAY81993.1
DQ022741 DQ022727 Genomic DNA Translation: AAY81995.1
DQ022741 DQ022727 Genomic DNA Translation: AAY81996.1
DQ022741 DQ022729 Genomic DNA Translation: AAY81997.1
AK134088 mRNA Translation: BAE22007.1
AL807764 Genomic DNA No translation available.
BC060648 mRNA Translation: AAH60648.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18822.1 [Q4PZA2-3]

NCBI Reference Sequences

More...
RefSeqi
NP_955011.1, NM_199307.2 [Q4PZA2-3]
XP_006538828.1, XM_006538765.1
XP_006538830.1, XM_006538767.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000102518; ENSMUSP00000099576; ENSMUSG00000057530 [Q4PZA2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
230857

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:230857

UCSC genome browser

More...
UCSCi
uc008vju.2, mouse [Q4PZA2-1]
uc008vjv.1, mouse [Q4PZA2-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ022741 DQ022729 Genomic DNA Translation: AAY81993.1
DQ022741 DQ022727 Genomic DNA Translation: AAY81995.1
DQ022741 DQ022727 Genomic DNA Translation: AAY81996.1
DQ022741 DQ022729 Genomic DNA Translation: AAY81997.1
AK134088 mRNA Translation: BAE22007.1
AL807764 Genomic DNA No translation available.
BC060648 mRNA Translation: AAH60648.1
CCDSiCCDS18822.1 [Q4PZA2-3]
RefSeqiNP_955011.1, NM_199307.2 [Q4PZA2-3]
XP_006538828.1, XM_006538765.1
XP_006538830.1, XM_006538767.3

3D structure databases

SMRiQ4PZA2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi231041, 3 interactors
STRINGi10090.ENSMUSP00000099576

Protein family/group databases

MEROPSiM13.002

PTM databases

GlyConnecti2289, 3 N-Linked glycans (3 sites)
GlyGeniQ4PZA2, 10 sites
iPTMnetiQ4PZA2
PhosphoSitePlusiQ4PZA2
SwissPalmiQ4PZA2

Proteomic databases

jPOSTiQ4PZA2
PaxDbiQ4PZA2
PeptideAtlasiQ4PZA2
PRIDEiQ4PZA2

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
772, 400 antibodies

Genome annotation databases

EnsembliENSMUST00000102518; ENSMUSP00000099576; ENSMUSG00000057530 [Q4PZA2-3]
GeneIDi230857
KEGGimmu:230857
UCSCiuc008vju.2, mouse [Q4PZA2-1]
uc008vjv.1, mouse [Q4PZA2-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1889
MGIiMGI:1101357, Ece1

Phylogenomic databases

eggNOGiKOG3624, Eukaryota
GeneTreeiENSGT00940000156050
HOGENOMiCLU_006187_8_0_1
InParanoidiQ4PZA2
KOiK01415
OMAiDQRFFMN
OrthoDBi282463at2759
PhylomeDBiQ4PZA2
TreeFamiTF315192

Enzyme and pathway databases

ReactomeiR-MMU-375276, Peptide ligand-binding receptors

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
230857, 1 hit in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ece1, mouse

Protein Ontology

More...
PROi
PR:Q4PZA2
RNActiQ4PZA2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000057530, Expressed in aortic valve and 309 other tissues
ExpressionAtlasiQ4PZA2, baseline and differential
GenevisibleiQ4PZA2, MM

Family and domain databases

CDDicd08662, M13, 1 hit
Gene3Di1.10.1380.10, 1 hit
3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR029734, ECE1
IPR024079, MetalloPept_cat_dom_sf
IPR000718, Peptidase_M13
IPR018497, Peptidase_M13_C
IPR042089, Peptidase_M13_dom_2
IPR008753, Peptidase_M13_N
PANTHERiPTHR11733, PTHR11733, 1 hit
PTHR11733:SF130, PTHR11733:SF130, 1 hit
PfamiView protein in Pfam
PF01431, Peptidase_M13, 1 hit
PF05649, Peptidase_M13_N, 1 hit
PRINTSiPR00786, NEPRILYSIN
PROSITEiView protein in PROSITE
PS51885, NEPRILYSIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiECE1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4PZA2
Secondary accession number(s): B1AXF9
, Q4PZ99, Q4PZA1, Q6P9Q9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 19, 2005
Last modified: August 12, 2020
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again