Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 97 (07 Apr 2021)
Sequence version 1 (02 Aug 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

Gene

Magi1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role as scaffolding protein at cell-cell junctions. May regulate acid-induced ASIC3 currents by modulating its expression at the cell surface.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi103 – 110ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
Alternative name(s):
BAI1-associated protein 1
Short name:
BAP-1
Membrane-associated guanylate kinase inverted 1
Short name:
MAGI-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Magi1
Synonyms:Baiap1, Bap1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
1586025, Magi1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane, Tight junction

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003162941 – 1255Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1Add BLAST1255

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei357PhosphoserineBy similarity1
Modified residuei729PhosphoserineBy similarity1
Modified residuei740PhosphoserineCombined sources1
Modified residuei799PhosphoserineBy similarity1
Modified residuei1070PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4L1J4

PRoteomics IDEntifications database

More...
PRIDEi
Q4L1J4

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4L1J4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4L1J4

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts through its WW 2 domain with SYNPO and through its PDZ 5 domain with ACTN4.

Interacts with cytoplasmic domain of ADGRB1.

Interacts via its WW domains with DRPLA (By similarity).

Interacts with ESAM, LRP2 and CXADR. May interact with CTNNB1.

Interacts through its PDZ 1 domain with NET1 (By similarity).

Interacts with ASIC3 and AMOT.

Interacts with FCHSD2 (By similarity).

Interacts with IGSF5/JAM4 and through its PDZ 2 and 3 domains with NPHS1 forming a tripartite complex (PubMed:16155592).

Interacts with DDN (PubMed:16751601). May interact (via PDZ domain) with RAPGEF2 (By similarity).

Interacts with DLL1 (By similarity).

Interacts with KCNJ10 and possibly with KCNJ10/KCNJ16 heterodimer; this interaction may facilitate KCNJ10/KCNJ16 potassium channel expression at the basolateral membrane in kidney tubular cells (By similarity).

Interacts with PRRG4 (via cytoplasmic domain) (By similarity).

By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
271569, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q4L1J4, 7 interactors

Molecular INTeraction database

More...
MINTi
Q4L1J4

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000065881

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q4L1J4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4L1J4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini17 – 105PDZ 1PROSITE-ProRule annotationAdd BLAST89
Domaini96 – 287Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST192
Domaini300 – 333WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini359 – 392WW 2PROSITE-ProRule annotationAdd BLAST34
Domaini471 – 553PDZ 2PROSITE-ProRule annotationAdd BLAST83
Domaini642 – 720PDZ 3PROSITE-ProRule annotationAdd BLAST79
Domaini840 – 922PDZ 4PROSITE-ProRule annotationAdd BLAST83
Domaini997 – 1093PDZ 5PROSITE-ProRule annotationAdd BLAST97
Domaini1151 – 1233PDZ 6PROSITE-ProRule annotationAdd BLAST83

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi237 – 242Poly-Glu6
Compositional biasi399 – 420Gln-richAdd BLAST22
Compositional biasi977 – 987Poly-GlyAdd BLAST11

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3209, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4L1J4

Identification of Orthologs from Complete Genome Data

More...
OMAi
PPTYLYN

Database of Orthologous Groups

More...
OrthoDBi
284488at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4L1J4

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00201, WW, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.42.10, 6 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008145, GK/Ca_channel_bsu
IPR008144, Guanylate_kin-like_dom
IPR020590, Guanylate_kinase_CS
IPR030033, MAGI1
IPR027417, P-loop_NTPase
IPR001478, PDZ
IPR036034, PDZ_sf
IPR001202, WW_dom
IPR036020, WW_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10316:SF12, PTHR10316:SF12, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF00595, PDZ, 5 hits
PF00397, WW, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072, GuKc, 1 hit
SM00228, PDZ, 6 hits
SM00456, WW, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156, SSF50156, 6 hits
SSF51045, SSF51045, 2 hits
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856, GUANYLATE_KINASE_1, 1 hit
PS50052, GUANYLATE_KINASE_2, 1 hit
PS50106, PDZ, 6 hits
PS01159, WW_DOMAIN_1, 2 hits
PS50020, WW_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4L1J4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKVIQKKNH WTGRVHECTV KRGPQGELGV TVLGGAEHGE FPYVGAVAAA
60 70 80 90 100
EAAGLPGGGE GPKLAEGELL LEVQGVRVSG LPRYDVLGVI DSCKEAVTFK
110 120 130 140 150
AVRQGGRLNK DLRHFLNQRF QKGSPDHELQ QTIRDNLYRH AVPCTTRSPR
160 170 180 190 200
EGEVPGVDYS FLTVKEFLDL EQSGTLLEVG TYEGNYYGTP KPPSQPVSGK
210 220 230 240 250
VITTDALHSL QSGSKQSTPK RTKSYNDMQN AGIVHTENEE EEDVPEMNSS
260 270 280 290 300
FTADSGDQDE PTLQEATLPP VNSSALAAPI TDPSQKFPQY LPLSAEDNLG
310 320 330 340 350
PLPENWEMAY TENGEVYFID HNAKTTSWLD PRCLNKQQKP LEECEDDEGV
360 370 380 390 400
HTEELDSELE LPAGWEKIED PVYGVYYVDH INRKTQYENP VLEAKRKRQL
410 420 430 440 450
EQQQQQQQHQ QQPQQPQPPQ PEEWTEDHAS VVPPVAPSHP PSNPEPAREA
460 470 480 490 500
PLQGKPFFTR NPSELEGKFI HTKLRKSSRG FGFTVVGGDE PDEFLQIKSL
510 520 530 540 550
VLDGPAALDG KMETGDVIVS VNDTCVLGHT HAQVVKIFQS IPIGASVDLE
560 570 580 590 600
LCRGYPLPFD PDDPNTSLVT SVAILDKEPI IVNGQETYDS PASHSSKTGK
610 620 630 640 650
VSNMKDARPS SPADVASNSS HGYPNDTVSL ASSIATQPEL ITVHIVKGPM
660 670 680 690 700
GFGFTIADSP GGGGQRVKQI VDSPRCRGLK EGDLIVEVNK RNVQALTHNQ
710 720 730 740 750
VVDMLIECPK GSEVTLLVQR GGLPVPKKSP KSQPLERKDS QNSSQHSVSS
760 770 780 790 800
LRSLHTASPS HSAQVLPEYP PADVPAPDQT DSSGQKKPDP FKIWAQSRSM
810 820 830 840 850
YEDRPMSPSP ASGLSKGERD REINSTNFGE CQIPDYQEQD IFLWRKETGF
860 870 880 890 900
GFRILGGNEP GEPIYIGHIV PLGAADTDGR LRSGDELICV DGTPVIGKSH
910 920 930 940 950
QLVVQLMQQA AKQGHVNLTV RRKVVFTVPK AENEVPSPAS SHHSSNQPAS
960 970 980 990 1000
LTEEKRTPQG SQNSLNTVSS GSGSTSGIGS GGGGGSGVVS AVLQPYDVEI
1010 1020 1030 1040 1050
RRGENEGFGF VIVSSVSRPE AGTTFAGNAC VAMPHKIGRI IEGSPADRCG
1060 1070 1080 1090 1100
KLKVGDRILA VNGCSITNKS HSDIVNLIKE AGNTVTLRII PGDESSNATL
1110 1120 1130 1140 1150
LTNAEKIATI TTTHAPSQQG TQETRTTTKP KPDSQFEFKG PQATQEQDFY
1160 1170 1180 1190 1200
TVELERGAKG FGFSLRGGRE YNMDLYVLRL AEDGPAERCG KMRIGDEILE
1210 1220 1230 1240 1250
INGETTKNMK HSRAIELIKN GGRRVRLFLR RGDGSVPEYG GSNYENIPSF

PGMTP
Length:1,255
Mass (Da):136,327
Last modified:August 2, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1024AC37A6C44802
GO
Isoform 2 (identifier: Q4L1J4-2) [UniParc]FASTAAdd to basket
Also known as: NT-short isoform

The sequence of this isoform differs from the canonical sequence as follows:
     1-211: Missing.
     212-216: SGSKQ → MHREA
     803-833: DRPMSPSPASGLSKGERDREINSTNFGECQI → NRL

Show »
Length:1,016
Mass (Da):110,614
Checksum:i649E89E21B56F3D5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JZE4A0A0G2JZE4_RAT
Membrane-associated guanylate kinas...
Magi1
1,337Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R8T1M0R8T1_RAT
Membrane-associated guanylate kinas...
Magi1
1,159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1M7H7F1M7H7_RAT
Membrane-associated guanylate kinas...
Magi1
1,011Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti323A → T in AAT99088 (Ref. 1) Curated1
Sequence conflicti466E → K in AAT99088 (Ref. 1) Curated1
Sequence conflicti648G → E in AAT99088 (Ref. 1) Curated1
Sequence conflicti780T → A in AAT99088 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0307621 – 211Missing in isoform 2. 1 PublicationAdd BLAST211
Alternative sequenceiVSP_030763212 – 216SGSKQ → MHREA in isoform 2. 1 Publication5
Alternative sequenceiVSP_030764803 – 833DRPMS…GECQI → NRL in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY598951 mRNA Translation: AAT99088.1
AY598952 mRNA Translation: AAT99089.1

NCBI Reference Sequences

More...
RefSeqi
NP_001025216.1, NM_001030045.1 [Q4L1J4-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
500261

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:500261

UCSC genome browser

More...
UCSCi
RGD:1586025, rat [Q4L1J4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY598951 mRNA Translation: AAT99088.1
AY598952 mRNA Translation: AAT99089.1
RefSeqiNP_001025216.1, NM_001030045.1 [Q4L1J4-1]

3D structure databases

BMRBiQ4L1J4
SMRiQ4L1J4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi271569, 4 interactors
IntActiQ4L1J4, 7 interactors
MINTiQ4L1J4
STRINGi10116.ENSRNOP00000065881

PTM databases

iPTMnetiQ4L1J4
PhosphoSitePlusiQ4L1J4

Proteomic databases

PaxDbiQ4L1J4
PRIDEiQ4L1J4

Genome annotation databases

GeneIDi500261
KEGGirno:500261
UCSCiRGD:1586025, rat [Q4L1J4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9223
RGDi1586025, Magi1

Phylogenomic databases

eggNOGiKOG3209, Eukaryota
InParanoidiQ4L1J4
OMAiPPTYLYN
OrthoDBi284488at2759
PhylomeDBiQ4L1J4

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q4L1J4

Family and domain databases

CDDicd00201, WW, 2 hits
Gene3Di2.30.42.10, 6 hits
InterProiView protein in InterPro
IPR008145, GK/Ca_channel_bsu
IPR008144, Guanylate_kin-like_dom
IPR020590, Guanylate_kinase_CS
IPR030033, MAGI1
IPR027417, P-loop_NTPase
IPR001478, PDZ
IPR036034, PDZ_sf
IPR001202, WW_dom
IPR036020, WW_dom_sf
PANTHERiPTHR10316:SF12, PTHR10316:SF12, 1 hit
PfamiView protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF00595, PDZ, 5 hits
PF00397, WW, 2 hits
SMARTiView protein in SMART
SM00072, GuKc, 1 hit
SM00228, PDZ, 6 hits
SM00456, WW, 2 hits
SUPFAMiSSF50156, SSF50156, 6 hits
SSF51045, SSF51045, 2 hits
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856, GUANYLATE_KINASE_1, 1 hit
PS50052, GUANYLATE_KINASE_2, 1 hit
PS50106, PDZ, 6 hits
PS01159, WW_DOMAIN_1, 2 hits
PS50020, WW_DOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAGI1_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4L1J4
Secondary accession number(s): Q4L1J5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: August 2, 2005
Last modified: April 7, 2021
This is version 97 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again