Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1

Gene

PLCH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by calcium-activated phosphatidylinositol-specific phospholipase C enzymes.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei314PROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi315Calcium 1; catalyticBy similarity1
Metal bindingi344Calcium 1; catalyticBy similarity1
Metal bindingi346Calcium 1; catalyticBy similarity1
Active sitei358PROSITE-ProRule annotation1
Metal bindingi393Calcium 1; catalyticBy similarity1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei442SubstrateBy similarity1
Binding sitei444SubstrateBy similarity1
Binding sitei627SubstrateBy similarity1
Binding sitei654SubstrateBy similarity1
Metal bindingi758Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi760Calcium 2By similarity1
Metal bindingi784Calcium 2By similarity1
Metal bindingi813Calcium 3By similarity1
Metal bindingi814Calcium 3; via carbonyl oxygenBy similarity1
Metal bindingi815Calcium 3By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi155 – 166PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium-dependent phospholipase C activity Source: MGI
  • calcium ion binding Source: InterPro
  • phosphatidylinositol phospholipase C activity Source: Reactome
  • phospholipase C activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.11 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000940

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-eta-1
Phospholipase C-eta-1
Short name:
PLC-eta-1
Phospholipase C-like protein 3
Short name:
PLC-L3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLCH1
Synonyms:KIAA1069, PLCL3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000114805.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29185 PLCH1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612835 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4KWH8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23007

Open Targets

More...
OpenTargetsi
ENSG00000114805

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394595

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLCH1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121947010

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003290071 – 16931-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1Add BLAST1693

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q4KWH8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q4KWH8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4KWH8

PeptideAtlas

More...
PeptideAtlasi
Q4KWH8

PRoteomics IDEntifications database

More...
PRIDEi
Q4KWH8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62214
62215 [Q4KWH8-2]
62216 [Q4KWH8-3]
62217 [Q4KWH8-4]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q4KWH8

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4KWH8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4KWH8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and to a lower extent in lung. In brain, it is found in cerebrum, cerebellum and spinal cord.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000114805 Expressed in 146 organ(s), highest expression level in pigmented layer of retina

CleanEx database of gene expression profiles

More...
CleanExi
HS_PLCH1

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4KWH8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036176
HPA057978

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116651, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q4KWH8, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000345988

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q4KWH8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4KWH8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 128PHPROSITE-ProRule annotationAdd BLAST109
Domaini142 – 177EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini178 – 214EF-hand 2PROSITE-ProRule annotationAdd BLAST37
Domaini299 – 444PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST146
Domaini601 – 714PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST114
Domaini719 – 826C2PROSITE-ProRule annotationAdd BLAST108

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1026 – 1030Poly-Ser5

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0169 Eukaryota
ENOG410XPSW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157185

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG095591

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4KWH8

KEGG Orthology (KO)

More...
KOi
K19006

Identification of Orthologs from Complete Genome Data

More...
OMAi
SIKDPHF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G02KH

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4KWH8

TreeFam database of animal gene trees

More...
TreeFami
TF313216

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001192 PI-PLC_fam
IPR028392 PLC-eta1
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...
PANTHERi
PTHR10336 PTHR10336, 1 hit
PTHR10336:SF51 PTHR10336:SF51, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00390 PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 1 hit
SM00054 EFh, 2 hits
SM00233 PH, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004 C2, 1 hit
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 3 hits
PS50003 PH_DOMAIN, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4KWH8-1) [UniParc]FASTAAdd to basket
Also known as: PLC-eta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADLEVYKNL SPEKVERCMS VMQSGTQMIK LKRGTKGLVR LFYLDEHRTR
60 70 80 90 100
LRWRPSRKSE KAKILIDSIY KVTEGRQSEI FHRQAEGNFD PSCCFTIYHG
110 120 130 140 150
NHMESLDLIT SNPEEARTWI TGLKYLMAGI SDEDSLAKRQ RTHDQWVKQT
160 170 180 190 200
FEEADKNGDG LLNIEEIHQL MHKLNVNLPR RKVRQMFQEA DTDENQGTLT
210 220 230 240 250
FEEFCVFYKM MSLRRDLYLL LLSYSDKKDH LTVEELAQFL KVEQKMNNVT
260 270 280 290 300
TDYCLDIIKK FEVSEENKVK NVLGIEGFTN FMRSPACDIF NPLHHEVYQD
310 320 330 340 350
MDQPLCNYYI ASSHNTYLTG DQLLSQSKVD MYARVLQEGC RCVEVDCWDG
360 370 380 390 400
PDGEPVVHHG YTLTSKILFR DVVETINKHA FVKNEFPVIL SIENHCSIQQ
410 420 430 440 450
QRKIAQYLKG IFGDKLDLSS VDTGECKQLP SPQSLKGKIL VKGKKLPYHL
460 470 480 490 500
GDDAEEGEVS DEDSADEIED ECKFKLHYSN GTTEHQVESF IRKKLESLLK
510 520 530 540 550
ESQIRDKEDP DSFTVRALLK ATHEGLNAHL KQSPDVKESG KKSHGRSLMT
560 570 580 590 600
NFGKHKKTTK SRSKSYSTDD EEDTQQSTGK EGGQLYRLGR RRKTMKLCRE
610 620 630 640 650
LSDLVVYTNS VAAQDIVDDG TTGNVLSFSE TRAHQVVQQK SEQFMIYNQK
660 670 680 690 700
QLTRIYPSAY RIDSSNFNPL PYWNAGCQLV ALNYQSEGRM MQLNRAKFKA
710 720 730 740 750
NGNCGYVLKP QQMCKGTFNP FSGDPLPANP KKQLILKVIS GQQLPKPPDS
760 770 780 790 800
MFGDRGEIID PFVEVEIIGL PVDCCKDQTR VVDDNGFNPV WEETLTFTVH
810 820 830 840 850
MPEIALVRFL VWDHDPIGRD FVGQRTVTFS SLVPGYRHVY LEGLTEASIF
860 870 880 890 900
VHITINEIYG KWSPLILNPS YTILHFLGAT KNRQLQGLKG LFNKNPRHSS
910 920 930 940 950
SENNSHYVRK RSIGDRILRR TASAPAKGRK KSKMGFQEMV EIKDSVSEAT
960 970 980 990 1000
RDQDGVLRRT TRSLQARPVS MPVDRNLLGA LSLPVSETAK DIEGKENSLA
1010 1020 1030 1040 1050
EDKDGRRKGK ASIKDPHFLN FNKKLSSSSS ALLHKDTSQG DTIVSTAHMS
1060 1070 1080 1090 1100
VTGEQLGMSS PRGGRTTSNA TSNCQENPCP SKSLSPKQHL APDPVVNPTQ
1110 1120 1130 1140 1150
DLHGVKIKEK GNPEDFVEGK SILSGSVLSH SNLEIKNLEG NRGKGRAATS
1160 1170 1180 1190 1200
FSLSDVSMLC SDIPDLHSTA ILQESVISHL IDNVTLTNEN EPGSSISALI
1210 1220 1230 1240 1250
GQFDETNNQA LTVVSHLHNT SVMSGHCPLP SLGLKMPIKH GFCKGKSKSS
1260 1270 1280 1290 1300
FLCSSPELIA LSSSETTKHA TNTVYETTCT PISKTKPDDD LSSKAKTAAL
1310 1320 1330 1340 1350
ESNLPGSPNT SRGWLPKSPT KGEDWETLKS CSPASSPDLT LEDVIADPTL
1360 1370 1380 1390 1400
CFNSGESSLV EIDGESENLS LTTCEYRREG TSQLASPLKL KYNQGVVEHF
1410 1420 1430 1440 1450
QRGLRNGYCK ETLRPSVPEI FNNIQDVKTQ SISYLAYQGA GFVHNHFSDS
1460 1470 1480 1490 1500
DAKMFQTCVP QQSSAQDMHV PVPKQLAHLP LPALKLPSPC KSKSLGDLTS
1510 1520 1530 1540 1550
EDIACNFESK YQCISKSFVT TGIRDKKGVT VKTKSLEPID ALTEQLRKLV
1560 1570 1580 1590 1600
SFDQEDNCQV LYSKQDANQL PRALVRKLSS RSQSRVRNIA SRAKEKQEAN
1610 1620 1630 1640 1650
KQKVPNPSNG AGVVLRNKPS APTPAVNRHS TGSYIAGYLK NTKGGGLEGR
1660 1670 1680 1690
GIPEGACTAL HYGHVDQFCS DNSVLQTEPS SDDKPEIYFL LRL
Length:1,693
Mass (Da):189,223
Last modified:August 2, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i00F2ADD21C4D14E6
GO
Isoform 2 (identifier: Q4KWH8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: Missing.
     862-881: Missing.

Note: No experimental confirmation available.
Show »
Length:1,655
Mass (Da):184,863
Checksum:i42135E91A9064CEF
GO
Isoform 3 (identifier: Q4KWH8-3) [UniParc]FASTAAdd to basket
Also known as: PLC-eta-1a

The sequence of this isoform differs from the canonical sequence as follows:
     1000-1002: AED → VQI
     1003-1693: Missing.

Show »
Length:1,002
Mass (Da):114,506
Checksum:i333C3E46F453A55D
GO
Isoform 4 (identifier: Q4KWH8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     862-881: Missing.
     1000-1034: AEDKDGRRKGKASIKDPHFLNFNKKLSSSSSALLH → DSSFCRPTEQAKAEMCKVPFPRQLECVMKMEISET
     1035-1693: Missing.

Note: No experimental confirmation available.
Show »
Length:1,014
Mass (Da):115,945
Checksum:i74AA8EB84E16050F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2U3TZV8A0A2U3TZV8_HUMAN
Phosphoinositide phospholipase C
PLCH1
1,685Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14129 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0329011 – 18Missing in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_032902862 – 881Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_0329031000 – 1034AEDKD…SALLH → DSSFCRPTEQAKAEMCKVPF PRQLECVMKMEISET in isoform 4. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0329041000 – 1002AED → VQI in isoform 3. 2 Publications3
Alternative sequenceiVSP_0329051003 – 1693Missing in isoform 3. 2 PublicationsAdd BLAST691
Alternative sequenceiVSP_0329061035 – 1693Missing in isoform 4. 1 PublicationAdd BLAST659

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY691170 mRNA Translation: AAW22607.1
AY691171 mRNA Translation: AAW22608.1
BC043248 mRNA Translation: AAH43248.2
BC113950 mRNA Translation: AAI13951.1
AB028992 mRNA Translation: BAA83021.1
AK022610 mRNA Translation: BAB14129.1 Different initiation.
CR749869 mRNA Translation: CAH18710.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46939.1 [Q4KWH8-1]
CCDS46940.1 [Q4KWH8-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001124432.1, NM_001130960.1 [Q4KWH8-1]
NP_001124433.1, NM_001130961.1 [Q4KWH8-3]
NP_055811.1, NM_014996.2
XP_016861418.1, XM_017005929.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.567423

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000334686; ENSP00000335469; ENSG00000114805 [Q4KWH8-2]
ENST00000340059; ENSP00000345988; ENSG00000114805 [Q4KWH8-1]
ENST00000447496; ENSP00000402759; ENSG00000114805 [Q4KWH8-3]
ENST00000494598; ENSP00000419100; ENSG00000114805 [Q4KWH8-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23007

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23007

UCSC genome browser

More...
UCSCi
uc062pff.1 human [Q4KWH8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY691170 mRNA Translation: AAW22607.1
AY691171 mRNA Translation: AAW22608.1
BC043248 mRNA Translation: AAH43248.2
BC113950 mRNA Translation: AAI13951.1
AB028992 mRNA Translation: BAA83021.1
AK022610 mRNA Translation: BAB14129.1 Different initiation.
CR749869 mRNA Translation: CAH18710.1
CCDSiCCDS46939.1 [Q4KWH8-1]
CCDS46940.1 [Q4KWH8-3]
RefSeqiNP_001124432.1, NM_001130960.1 [Q4KWH8-1]
NP_001124433.1, NM_001130961.1 [Q4KWH8-3]
NP_055811.1, NM_014996.2
XP_016861418.1, XM_017005929.1
UniGeneiHs.567423

3D structure databases

ProteinModelPortaliQ4KWH8
SMRiQ4KWH8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116651, 11 interactors
IntActiQ4KWH8, 4 interactors
STRINGi9606.ENSP00000345988

Chemistry databases

SwissLipidsiSLP:000000940

PTM databases

CarbonylDBiQ4KWH8
iPTMnetiQ4KWH8
PhosphoSitePlusiQ4KWH8

Polymorphism and mutation databases

BioMutaiPLCH1
DMDMi121947010

Proteomic databases

EPDiQ4KWH8
MaxQBiQ4KWH8
PaxDbiQ4KWH8
PeptideAtlasiQ4KWH8
PRIDEiQ4KWH8
ProteomicsDBi62214
62215 [Q4KWH8-2]
62216 [Q4KWH8-3]
62217 [Q4KWH8-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334686; ENSP00000335469; ENSG00000114805 [Q4KWH8-2]
ENST00000340059; ENSP00000345988; ENSG00000114805 [Q4KWH8-1]
ENST00000447496; ENSP00000402759; ENSG00000114805 [Q4KWH8-3]
ENST00000494598; ENSP00000419100; ENSG00000114805 [Q4KWH8-4]
GeneIDi23007
KEGGihsa:23007
UCSCiuc062pff.1 human [Q4KWH8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23007
DisGeNETi23007
EuPathDBiHostDB:ENSG00000114805.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLCH1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0119148
HGNCiHGNC:29185 PLCH1
HPAiHPA036176
HPA057978
MIMi612835 gene
neXtProtiNX_Q4KWH8
OpenTargetsiENSG00000114805
PharmGKBiPA128394595

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
GeneTreeiENSGT00940000157185
HOVERGENiHBG095591
InParanoidiQ4KWH8
KOiK19006
OMAiSIKDPHF
OrthoDBiEOG091G02KH
PhylomeDBiQ4KWH8
TreeFamiTF313216

Enzyme and pathway databases

BRENDAi3.1.4.11 2681
ReactomeiR-HSA-1855204 Synthesis of IP3 and IP4 in the cytosol

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLCH1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23007

Protein Ontology

More...
PROi
PR:Q4KWH8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000114805 Expressed in 146 organ(s), highest expression level in pigmented layer of retina
CleanExiHS_PLCH1
GenevisibleiQ4KWH8 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001192 PI-PLC_fam
IPR028392 PLC-eta1
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PTHR10336:SF51 PTHR10336:SF51, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00054 EFh, 2 hits
SM00233 PH, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 3 hits
PS50003 PH_DOMAIN, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCH1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4KWH8
Secondary accession number(s): Q29RV9
, Q4KWH9, Q68CN0, Q86XK4, Q9H9U2, Q9UPT3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: August 2, 2005
Last modified: December 5, 2018
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again