Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 52B

Gene

TMEM52B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 52B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMEM52B
Synonyms:C12orf59
ORF Names:UNQ5927/PRO19821
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000165685.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26438 TMEM52B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4KMG9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei40 – 60HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
120939

Open Targets

More...
OpenTargetsi
ENSG00000165685

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485388

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121944266

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000029444825 – 183Transmembrane protein 52BAdd BLAST159

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4KMG9

PeptideAtlas

More...
PeptideAtlasi
Q4KMG9

PRoteomics IDEntifications database

More...
PRIDEi
Q4KMG9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62195
62196 [Q4KMG9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4KMG9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4KMG9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000165685 Expressed in 96 organ(s), highest expression level in metanephros

CleanEx database of gene expression profiles

More...
CleanExi
HS_C12orf59

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4KMG9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4KMG9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA058096

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125702, 35 interactors

Protein interaction database and analysis system

More...
IntActi
Q4KMG9, 64 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000298530

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q4KMG9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEQA Eukaryota
ENOG410YQ2H LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111328

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111764

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG099707

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4KMG9

Identification of Orthologs from Complete Genome Data

More...
OMAi
VSPEHCL

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0RXR

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4KMG9

TreeFam database of animal gene trees

More...
TreeFami
TF336037

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038942 TMEM52

The PANTHER Classification System

More...
PANTHERi
PTHR33955 PTHR33955, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4KMG9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGVRVHVVAA SALLYFILLS GTRCEENCGN PEHCLTTDWV HLWYIWLLVV
60 70 80 90 100
IGALLLLCGL TSLCFRCCCL SRQQNGEDGG PPPCEVTVIA FDHDSTLQST
110 120 130 140 150
ITSLQSVFGP AARRILAVAH SHSSLGQLPS SLDTLPGYEE ALHMSRFTVA
160 170 180
MCGQKAPDLP PVPEEKQLPP TEKESTRIVD SWN
Length:183
Mass (Da):20,002
Last modified:August 2, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF79A3C7EEDC2360
GO
Isoform 2 (identifier: Q4KMG9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MGVRVHVVAASALLYFILLSGTRCEENCGNPEH → MSWRPQPCCISSC

Show »
Length:163
Mass (Da):17,913
Checksum:i818AA784EC6632D8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H230F5H230_HUMAN
Transmembrane protein 52B
TMEM52B
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0266401 – 33MGVRV…GNPEH → MSWRPQPCCISSC in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358845 mRNA Translation: AAQ89204.1
AK055728 mRNA Translation: BAB70998.1
AC115676 Genomic DNA No translation available.
BC098571 mRNA Translation: AAH98571.1
BC131523 mRNA Translation: AAI31524.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS66314.1 [Q4KMG9-1]
CCDS8619.1 [Q4KMG9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001073283.1, NM_001079815.1 [Q4KMG9-1]
NP_694567.1, NM_153022.3 [Q4KMG9-2]
XP_006719092.1, XM_006719029.2 [Q4KMG9-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.226422

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000298530; ENSP00000298530; ENSG00000165685 [Q4KMG9-2]
ENST00000381923; ENSP00000371348; ENSG00000165685 [Q4KMG9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
120939

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:120939

UCSC genome browser

More...
UCSCi
uc001qxq.4 human [Q4KMG9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358845 mRNA Translation: AAQ89204.1
AK055728 mRNA Translation: BAB70998.1
AC115676 Genomic DNA No translation available.
BC098571 mRNA Translation: AAH98571.1
BC131523 mRNA Translation: AAI31524.1
CCDSiCCDS66314.1 [Q4KMG9-1]
CCDS8619.1 [Q4KMG9-2]
RefSeqiNP_001073283.1, NM_001079815.1 [Q4KMG9-1]
NP_694567.1, NM_153022.3 [Q4KMG9-2]
XP_006719092.1, XM_006719029.2 [Q4KMG9-1]
UniGeneiHs.226422

3D structure databases

ProteinModelPortaliQ4KMG9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125702, 35 interactors
IntActiQ4KMG9, 64 interactors
STRINGi9606.ENSP00000298530

PTM databases

iPTMnetiQ4KMG9
PhosphoSitePlusiQ4KMG9

Polymorphism and mutation databases

DMDMi121944266

Proteomic databases

PaxDbiQ4KMG9
PeptideAtlasiQ4KMG9
PRIDEiQ4KMG9
ProteomicsDBi62195
62196 [Q4KMG9-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298530; ENSP00000298530; ENSG00000165685 [Q4KMG9-2]
ENST00000381923; ENSP00000371348; ENSG00000165685 [Q4KMG9-1]
GeneIDi120939
KEGGihsa:120939
UCSCiuc001qxq.4 human [Q4KMG9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
120939
DisGeNETi120939
EuPathDBiHostDB:ENSG00000165685.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMEM52B

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0010423
HGNCiHGNC:26438 TMEM52B
HPAiHPA058096
neXtProtiNX_Q4KMG9
OpenTargetsiENSG00000165685
PharmGKBiPA143485388

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEQA Eukaryota
ENOG410YQ2H LUCA
GeneTreeiENSGT00730000111328
HOGENOMiHOG000111764
HOVERGENiHBG099707
InParanoidiQ4KMG9
OMAiVSPEHCL
OrthoDBiEOG091G0RXR
PhylomeDBiQ4KMG9
TreeFamiTF336037

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMEM52B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
120939

Protein Ontology

More...
PROi
PR:Q4KMG9

Gene expression databases

BgeeiENSG00000165685 Expressed in 96 organ(s), highest expression level in metanephros
CleanExiHS_C12orf59
ExpressionAtlasiQ4KMG9 baseline and differential
GenevisibleiQ4KMG9 HS

Family and domain databases

InterProiView protein in InterPro
IPR038942 TMEM52
PANTHERiPTHR33955 PTHR33955, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM52B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4KMG9
Secondary accession number(s): Q96NA7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: August 2, 2005
Last modified: November 7, 2018
This is version 89 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again