Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 52B

Gene

TMEM52B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protein 52B
Gene namesi
Name:TMEM52B
Synonyms:C12orf59
ORF Names:UNQ5927/PRO19821
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000165685.8
HGNCiHGNC:26438 TMEM52B
neXtProtiNX_Q4KMG9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei40 – 60HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi120939
OpenTargetsiENSG00000165685
PharmGKBiPA143485388

Polymorphism and mutation databases

DMDMi121944266

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000029444825 – 183Transmembrane protein 52BAdd BLAST159

Proteomic databases

PaxDbiQ4KMG9
PeptideAtlasiQ4KMG9
PRIDEiQ4KMG9
ProteomicsDBi62195
62196 [Q4KMG9-2]

PTM databases

iPTMnetiQ4KMG9
PhosphoSitePlusiQ4KMG9

Expressioni

Gene expression databases

BgeeiENSG00000165685 Expressed in 96 organ(s), highest expression level in metanephros
CleanExiHS_C12orf59
ExpressionAtlasiQ4KMG9 baseline and differential
GenevisibleiQ4KMG9 HS

Organism-specific databases

HPAiHPA058096

Interactioni

Protein-protein interaction databases

BioGridi125702, 35 interactors
IntActiQ4KMG9, 64 interactors
STRINGi9606.ENSP00000298530

Structurei

3D structure databases

ProteinModelPortaliQ4KMG9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEQA Eukaryota
ENOG410YQ2H LUCA
GeneTreeiENSGT00730000111328
HOGENOMiHOG000111764
HOVERGENiHBG099707
InParanoidiQ4KMG9
OMAiCCCLSRQ
OrthoDBiEOG091G0RXR
PhylomeDBiQ4KMG9
TreeFamiTF336037

Family and domain databases

InterProiView protein in InterPro
IPR038942 TMEM52
PANTHERiPTHR33955 PTHR33955, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: Q4KMG9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGVRVHVVAA SALLYFILLS GTRCEENCGN PEHCLTTDWV HLWYIWLLVV
60 70 80 90 100
IGALLLLCGL TSLCFRCCCL SRQQNGEDGG PPPCEVTVIA FDHDSTLQST
110 120 130 140 150
ITSLQSVFGP AARRILAVAH SHSSLGQLPS SLDTLPGYEE ALHMSRFTVA
160 170 180
MCGQKAPDLP PVPEEKQLPP TEKESTRIVD SWN
Length:183
Mass (Da):20,002
Last modified:August 2, 2005 - v1
Checksum:iCF79A3C7EEDC2360
GO
Isoform 2 (identifier: Q4KMG9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MGVRVHVVAASALLYFILLSGTRCEENCGNPEH → MSWRPQPCCISSC

Show »
Length:163
Mass (Da):17,913
Checksum:i818AA784EC6632D8
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H230F5H230_HUMAN
Transmembrane protein 52B
TMEM52B
90Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0266401 – 33MGVRV…GNPEH → MSWRPQPCCISSC in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358845 mRNA Translation: AAQ89204.1
AK055728 mRNA Translation: BAB70998.1
AC115676 Genomic DNA No translation available.
BC098571 mRNA Translation: AAH98571.1
BC131523 mRNA Translation: AAI31524.1
CCDSiCCDS66314.1 [Q4KMG9-1]
CCDS8619.1 [Q4KMG9-2]
RefSeqiNP_001073283.1, NM_001079815.1 [Q4KMG9-1]
NP_694567.1, NM_153022.3 [Q4KMG9-2]
XP_006719092.1, XM_006719029.2 [Q4KMG9-1]
UniGeneiHs.226422

Genome annotation databases

EnsembliENST00000298530; ENSP00000298530; ENSG00000165685 [Q4KMG9-2]
ENST00000381923; ENSP00000371348; ENSG00000165685 [Q4KMG9-1]
GeneIDi120939
KEGGihsa:120939
UCSCiuc001qxq.4 human [Q4KMG9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTM52B_HUMAN
AccessioniPrimary (citable) accession number: Q4KMG9
Secondary accession number(s): Q96NA7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: August 2, 2005
Last modified: September 12, 2018
This is version 88 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again