Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 100 (17 Jun 2020)
Sequence version 1 (02 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transmembrane protein 52B

Gene

TMEM52B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 52B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMEM52B
Synonyms:C12orf59
ORF Names:UNQ5927/PRO19821
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000165685.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26438 TMEM52B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4KMG9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei40 – 60HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
120939

Open Targets

More...
OpenTargetsi
ENSG00000165685

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485388

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q4KMG9 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMEM52B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121944266

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000029444825 – 183Transmembrane protein 52BAdd BLAST159

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q4KMG9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4KMG9

PeptideAtlas

More...
PeptideAtlasi
Q4KMG9

PRoteomics IDEntifications database

More...
PRIDEi
Q4KMG9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62195 [Q4KMG9-1]
62196 [Q4KMG9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4KMG9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4KMG9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000165685 Expressed in metanephros and 95 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4KMG9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4KMG9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000165685 Tissue enriched (kidney)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q4KMG9
With#Exp.IntAct
ALG3 [Q92685]3EBI-18178701,EBI-2848814
APOD [P05090]3EBI-18178701,EBI-715495
APOL2 [Q9BQE5]3EBI-18178701,EBI-4290634
APOL3 - isoform 2 [O95236-2]3EBI-18178701,EBI-11976321
BET1 [O15155]3EBI-18178701,EBI-749204
BTN2A2 [Q8WVV5]3EBI-18178701,EBI-8648738
CLDN19 - isoform 2 [Q8N6F1-2]3EBI-18178701,EBI-12256978
CLDN4 [O14493]3EBI-18178701,EBI-9316372
CNIH1 [O95406]3EBI-18178701,EBI-12172273
CNIH3 [Q8TBE1]3EBI-18178701,EBI-12208021
CSGALNACT2 [Q8N6G5]3EBI-18178701,EBI-10267100
DNAJC30 [Q96LL9]3EBI-18178701,EBI-8639143
EMD [P50402]3EBI-18178701,EBI-489887
FXYD3 - isoform 3 [Q14802-3]3EBI-18178701,EBI-12175685
GAST [P01350]3EBI-18178701,EBI-3436637
GPR25 [O00155]3EBI-18178701,EBI-10178951
GPR37L1 [O60883]3EBI-18178701,EBI-2927498
IGFBP5 [P24593]3EBI-18178701,EBI-720480
INSIG2 [Q9Y5U4]3EBI-18178701,EBI-8503746
ITGAM [P11215]3EBI-18178701,EBI-2568251
JAGN1 [Q8N5M9]3EBI-18178701,EBI-10266796
LHFPL5 [Q8TAF8]3EBI-18178701,EBI-2820517
LPAR3 [Q9UBY5]3EBI-18178701,EBI-12033434
LTC4S [Q16873]3EBI-18178701,EBI-12241118
MAL [P21145]3EBI-18178701,EBI-3932027
MARCHF2 [Q9P0N8]3EBI-18178701,EBI-10317612
MIP [P30301]3EBI-18178701,EBI-8449636
MS4A13 [Q5J8X5]3EBI-18178701,EBI-12070086
NINJ2 [Q9NZG7]3EBI-18178701,EBI-10317425
NRM [Q8IXM6]3EBI-18178701,EBI-10262547
NSG1 [P42857]3EBI-18178701,EBI-6380741
ORMDL1 [Q9P0S3]3EBI-18178701,EBI-1054848
PGAP2 - isoform 5 [Q9UHJ9-5]3EBI-18178701,EBI-12092917
PLN [P26678]3EBI-18178701,EBI-692836
PLP1 - isoform DM-20 [P60201-2]3EBI-18178701,EBI-12188331
RTP2 [Q5QGT7]3EBI-18178701,EBI-10244780
SEC22A [Q96IW7]3EBI-18178701,EBI-8652744
SERP1 [Q9Y6X1]3EBI-18178701,EBI-10329948
SLC30A2 [Q9BRI3]3EBI-18178701,EBI-8644112
SLC30A8 [Q8IWU4]3EBI-18178701,EBI-10262251
SLC35A4 [Q96G79]3EBI-18178701,EBI-12363689
SLC35B4 [Q969S0]3EBI-18178701,EBI-10281213
SLC38A7 [Q9NVC3]3EBI-18178701,EBI-10314552
SMIM1 [B2RUZ4]3EBI-18178701,EBI-12188413
TF [P02787]3EBI-18178701,EBI-714319
TMEM100 [Q9NV29]3EBI-18178701,EBI-8644968
TMEM107 [Q6UX40]3EBI-18178701,EBI-12845616
TMEM109 [Q9BVC6]3EBI-18178701,EBI-1057733
TMEM128 - isoform 2 [Q5BJH2-2]3EBI-18178701,EBI-10694905
TMEM147 [Q9BVK8]3EBI-18178701,EBI-348587
TMEM14C [Q9P0S9]3EBI-18178701,EBI-2339195
TMEM189-UBE2V1 [I3L0A0]3EBI-18178701,EBI-12213001
TMEM203 [Q969S6]3EBI-18178701,EBI-12274070
TMEM218 [A2RU14]3EBI-18178701,EBI-10173151
TMEM267 [Q0VDI3]3EBI-18178701,EBI-17555467
TMEM50B [P56557]3EBI-18178701,EBI-12366453
TMEM54 [Q969K7]3EBI-18178701,EBI-3922833
TMEM60 [Q9H2L4]3EBI-18178701,EBI-2852148
TMEM86B [Q8N661]3EBI-18178701,EBI-2548832
TMEM97 [Q5BJF2]3EBI-18178701,EBI-12111910
TMUB2 [Q71RG4]3EBI-18178701,EBI-2820477
TRAM1L1 [Q8N609]3EBI-18178701,EBI-11996766
TTMP [Q5BVD1]3EBI-18178701,EBI-10243654
TUSC5 [A5PKU2]3EBI-18178701,EBI-11988865
VAMP3 [Q15836]3EBI-18178701,EBI-722343
VAMP5 [O95183]3EBI-18178701,EBI-10191195
ZDHHC15 [Q96MV8]3EBI-18178701,EBI-12837904

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
125702, 35 interactors

Protein interaction database and analysis system

More...
IntActi
Q4KMG9, 93 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000371348

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q4KMG9 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEQA Eukaryota
ENOG410YQ2H LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111328

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_100623_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4KMG9

Identification of Orthologs from Complete Genome Data

More...
OMAi
VSPEHCL

Database of Orthologous Groups

More...
OrthoDBi
1323580at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4KMG9

TreeFam database of animal gene trees

More...
TreeFami
TF336037

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038942 TMEM52

The PANTHER Classification System

More...
PANTHERi
PTHR33955 PTHR33955, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4KMG9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGVRVHVVAA SALLYFILLS GTRCEENCGN PEHCLTTDWV HLWYIWLLVV
60 70 80 90 100
IGALLLLCGL TSLCFRCCCL SRQQNGEDGG PPPCEVTVIA FDHDSTLQST
110 120 130 140 150
ITSLQSVFGP AARRILAVAH SHSSLGQLPS SLDTLPGYEE ALHMSRFTVA
160 170 180
MCGQKAPDLP PVPEEKQLPP TEKESTRIVD SWN
Length:183
Mass (Da):20,002
Last modified:August 2, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCF79A3C7EEDC2360
GO
Isoform 2 (identifier: Q4KMG9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MGVRVHVVAASALLYFILLSGTRCEENCGNPEH → MSWRPQPCCISSC

Show »
Length:163
Mass (Da):17,913
Checksum:i818AA784EC6632D8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H230F5H230_HUMAN
Transmembrane protein 52B
TMEM52B
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0266401 – 33MGVRV…GNPEH → MSWRPQPCCISSC in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358845 mRNA Translation: AAQ89204.1
AK055728 mRNA Translation: BAB70998.1
AC115676 Genomic DNA No translation available.
BC098571 mRNA Translation: AAH98571.1
BC131523 mRNA Translation: AAI31524.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS66314.1 [Q4KMG9-1]
CCDS8619.1 [Q4KMG9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001073283.1, NM_001079815.1 [Q4KMG9-1]
NP_694567.1, NM_153022.3 [Q4KMG9-2]
XP_006719092.1, XM_006719029.2 [Q4KMG9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000298530; ENSP00000298530; ENSG00000165685 [Q4KMG9-2]
ENST00000381923; ENSP00000371348; ENSG00000165685 [Q4KMG9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
120939

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:120939

UCSC genome browser

More...
UCSCi
uc001qxq.4 human [Q4KMG9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358845 mRNA Translation: AAQ89204.1
AK055728 mRNA Translation: BAB70998.1
AC115676 Genomic DNA No translation available.
BC098571 mRNA Translation: AAH98571.1
BC131523 mRNA Translation: AAI31524.1
CCDSiCCDS66314.1 [Q4KMG9-1]
CCDS8619.1 [Q4KMG9-2]
RefSeqiNP_001073283.1, NM_001079815.1 [Q4KMG9-1]
NP_694567.1, NM_153022.3 [Q4KMG9-2]
XP_006719092.1, XM_006719029.2 [Q4KMG9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi125702, 35 interactors
IntActiQ4KMG9, 93 interactors
STRINGi9606.ENSP00000371348

PTM databases

iPTMnetiQ4KMG9
PhosphoSitePlusiQ4KMG9

Polymorphism and mutation databases

BioMutaiTMEM52B
DMDMi121944266

Proteomic databases

MassIVEiQ4KMG9
PaxDbiQ4KMG9
PeptideAtlasiQ4KMG9
PRIDEiQ4KMG9
ProteomicsDBi62195 [Q4KMG9-1]
62196 [Q4KMG9-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23262 44 antibodies

Genome annotation databases

EnsembliENST00000298530; ENSP00000298530; ENSG00000165685 [Q4KMG9-2]
ENST00000381923; ENSP00000371348; ENSG00000165685 [Q4KMG9-1]
GeneIDi120939
KEGGihsa:120939
UCSCiuc001qxq.4 human [Q4KMG9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
120939
DisGeNETi120939
EuPathDBiHostDB:ENSG00000165685.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMEM52B
HGNCiHGNC:26438 TMEM52B
HPAiENSG00000165685 Tissue enriched (kidney)
neXtProtiNX_Q4KMG9
OpenTargetsiENSG00000165685
PharmGKBiPA143485388

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEQA Eukaryota
ENOG410YQ2H LUCA
GeneTreeiENSGT00730000111328
HOGENOMiCLU_100623_2_0_1
InParanoidiQ4KMG9
OMAiVSPEHCL
OrthoDBi1323580at2759
PhylomeDBiQ4KMG9
TreeFamiTF336037

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
120939 0 hits in 784 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
120939
PharosiQ4KMG9 Tdark

Protein Ontology

More...
PROi
PR:Q4KMG9
RNActiQ4KMG9 protein

Gene expression databases

BgeeiENSG00000165685 Expressed in metanephros and 95 other tissues
ExpressionAtlasiQ4KMG9 baseline and differential
GenevisibleiQ4KMG9 HS

Family and domain databases

InterProiView protein in InterPro
IPR038942 TMEM52
PANTHERiPTHR33955 PTHR33955, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM52B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4KMG9
Secondary accession number(s): Q96NA7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: August 2, 2005
Last modified: June 17, 2020
This is version 100 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again