Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor MYB59

Gene

MYB59

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Transcription factor.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi33 – 57H-T-H motifPROSITE-ProRule annotationAdd BLAST25
DNA bindingi85 – 108H-T-H motifPROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

  • cell differentiation Source: GO_Central
  • regulation of transcription by RNA polymerase II Source: GO_Central
  • response to cadmium ion Source: TAIR
  • response to chitin Source: TAIR
  • response to ethylene Source: TAIR
  • response to gibberellin Source: TAIR
  • response to jasmonic acid Source: TAIR
  • response to salicylic acid Source: TAIR
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor MYB59
Alternative name(s):
Myb-related protein 59
Short name:
AtMYB59
Gene namesi
Name:MYB59
Ordered Locus Names:At5g59780
ORF Names:MTH12.19
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

AraportiAT5G59780
TAIRilocus:2174324 AT5G59780

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002343591 – 235Transcription factor MYB59Add BLAST235

Proteomic databases

PaxDbiQ4JL84

Expressioni

Tissue specificityi

Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings.1 Publication

Inductioni

Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd).2 Publications

Gene expression databases

ExpressionAtlasiQ4JL84 baseline and differential
GenevisibleiQ4JL84 AT

Interactioni

Protein-protein interaction databases

STRINGi3702.AT5G59780.3

Structurei

3D structure databases

ProteinModelPortaliQ4JL84
SMRiQ4JL84
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 57HTH myb-type 1PROSITE-ProRule annotationAdd BLAST53
Domaini58 – 112HTH myb-type 2PROSITE-ProRule annotationAdd BLAST55

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi62 – 65Bipartite nuclear localization signal 1Sequence analysis4
Motifi109 – 117Bipartite nuclear localization signal 2Sequence analysis9

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0048 Eukaryota
COG5147 LUCA
InParanoidiQ4JL84
KOiK09422
OMAiTNGKMNQ
OrthoDBiEOG09360PCP
PhylomeDBiQ4JL84

Family and domain databases

CDDicd00167 SANT, 2 hits
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017930 Myb_dom
IPR001005 SANT/Myb
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 2 hits
SMARTiView protein in SMART
SM00717 SANT, 2 hits
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS51294 HTH_MYB, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MYB59-3 (identifier: Q4JL84-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLVQEEYRK GPWTEQEDIL LVNFVHLFGD RRWDFVAKVS GLNRTGKSCR
60 70 80 90 100
LRWVNYLHPG LKRGKMTPQE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI
110 120 130 140 150
KNYWRTHMRK KAQEKKRPMS PTSSSSNCCS SSMTTTTSQD TGGSNGKMNQ
160 170 180 190 200
ECEDGYYSMD DIWREIDQSG ANVIKPVKDN YYSEQSCYLN FPPLASPTWE
210 220 230
SSLESIWNMD ADESKMSSFA IDQFPLSFEH GSGRL
Length:235
Mass (Da):27,237
Last modified:May 16, 2006 - v2
Checksum:i35DB85B37C7CFC66
GO
Isoform MYB59-1 (identifier: Q4JL84-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:170
Mass (Da):19,482
Checksum:i57B05A0262DAA9DE
GO
Isoform MYB59-2 (identifier: Q4JL84-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-40: KLVQEEYRKGPWTEQEDILLVNFVHLFGDRRWDFVAKVS → GFCSESFRFEGGGRNIRI

Show »
Length:214
Mass (Da):24,520
Checksum:iBDEFD33404DEDE46
GO
Isoform MYB59-4 (identifier: Q4JL84-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-215: Missing.

Show »
Length:86
Mass (Da):10,113
Checksum:i54C33CCBF2708358
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti138S → T in AAC83616 (PubMed:9839469).Curated1
Sequence conflicti152C → G in AAC83616 (PubMed:9839469).Curated1
Sequence conflicti171 – 172AN → H in AAC83616 (PubMed:9839469).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0182911 – 65Missing in isoform MYB59-1. 2 PublicationsAdd BLAST65
Alternative sequenceiVSP_0182922 – 40KLVQE…VAKVS → GFCSESFRFEGGGRNIRI in isoform MYB59-2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_01829367 – 215Missing in isoform MYB59-4. 1 PublicationAdd BLAST149

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062894 mRNA Translation: AAC83616.1
AY519641 mRNA Translation: AAS10111.1
DQ075252 mRNA Translation: AAY97894.1
DQ075253 mRNA Translation: AAY97895.1
DQ075254 mRNA Translation: AAY97896.1
AB006705 Genomic DNA Translation: BAB09515.1
CP002688 Genomic DNA Translation: AED97231.1
CP002688 Genomic DNA Translation: AED97232.1
CP002688 Genomic DNA Translation: AED97233.1
AK229048 mRNA Translation: BAF00931.1
Z95781 mRNA Translation: CAB09213.1
Z95772 mRNA Translation: CAB09204.1
PIRiT51666
RefSeqiNP_200786.1, NM_125370.4 [Q4JL84-1]
NP_851225.1, NM_180894.4 [Q4JL84-2]
NP_851226.1, NM_180895.3 [Q4JL84-3]
UniGeneiAt.22428
At.70065

Genome annotation databases

EnsemblPlantsiAT5G59780.1; AT5G59780.1; AT5G59780 [Q4JL84-2]
AT5G59780.2; AT5G59780.2; AT5G59780 [Q4JL84-3]
AT5G59780.3; AT5G59780.3; AT5G59780 [Q4JL84-1]
GeneIDi836099
GrameneiAT5G59780.1; AT5G59780.1; AT5G59780 [Q4JL84-2]
AT5G59780.2; AT5G59780.2; AT5G59780 [Q4JL84-3]
AT5G59780.3; AT5G59780.3; AT5G59780 [Q4JL84-1]
KEGGiath:AT5G59780

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMYB59_ARATH
AccessioniPrimary (citable) accession number: Q4JL84
Secondary accession number(s): O50069
, Q0WPL8, Q4JL85, Q4JL86, Q7DLH5, Q9FN86
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: April 25, 2018
This is version 108 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health