Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (11 Dec 2019)
Sequence version 2 (16 May 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transcription factor MYB59

Gene

MYB59

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi33 – 57H-T-H motifPROSITE-ProRule annotationAdd BLAST25
DNA bindingi85 – 108H-T-H motifPROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor MYB59
Alternative name(s):
Myb-related protein 59
Short name:
AtMYB59
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MYB59
Ordered Locus Names:At5g59780
ORF Names:MTH12.19
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT5G59780

The Arabidopsis Information Resource

More...
TAIRi
locus:2174324 AT5G59780

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002343591 – 235Transcription factor MYB59Add BLAST235

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4JL84

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd).2 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4JL84 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4JL84 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
3702.AT5G59780.3

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4JL84

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 57HTH myb-type 1PROSITE-ProRule annotationAdd BLAST53
Domaini58 – 112HTH myb-type 2PROSITE-ProRule annotationAdd BLAST55

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi62 – 65Bipartite nuclear localization signal 1Sequence analysis4
Motifi109 – 117Bipartite nuclear localization signal 2Sequence analysis9

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0048 Eukaryota
COG5147 LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4JL84

KEGG Orthology (KO)

More...
KOi
K09422

Identification of Orthologs from Complete Genome Data

More...
OMAi
QEEHLVM

Database of Orthologous Groups

More...
OrthoDBi
1499244at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4JL84

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00167 SANT, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009057 Homeobox-like_sf
IPR017930 Myb_dom
IPR001005 SANT/Myb

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00249 Myb_DNA-binding, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00717 SANT, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51294 HTH_MYB, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform MYB59-3 (identifier: Q4JL84-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKLVQEEYRK GPWTEQEDIL LVNFVHLFGD RRWDFVAKVS GLNRTGKSCR
60 70 80 90 100
LRWVNYLHPG LKRGKMTPQE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI
110 120 130 140 150
KNYWRTHMRK KAQEKKRPMS PTSSSSNCCS SSMTTTTSQD TGGSNGKMNQ
160 170 180 190 200
ECEDGYYSMD DIWREIDQSG ANVIKPVKDN YYSEQSCYLN FPPLASPTWE
210 220 230
SSLESIWNMD ADESKMSSFA IDQFPLSFEH GSGRL
Length:235
Mass (Da):27,237
Last modified:May 16, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i35DB85B37C7CFC66
GO
Isoform MYB59-1 (identifier: Q4JL84-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:170
Mass (Da):19,482
Checksum:i57B05A0262DAA9DE
GO
Isoform MYB59-2 (identifier: Q4JL84-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-40: KLVQEEYRKGPWTEQEDILLVNFVHLFGDRRWDFVAKVS → GFCSESFRFEGGGRNIRI

Show »
Length:214
Mass (Da):24,520
Checksum:iBDEFD33404DEDE46
GO
Isoform MYB59-4 (identifier: Q4JL84-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-215: Missing.

Show »
Length:86
Mass (Da):10,113
Checksum:i54C33CCBF2708358
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti138S → T in AAC83616 (PubMed:9839469).Curated1
Sequence conflicti152C → G in AAC83616 (PubMed:9839469).Curated1
Sequence conflicti171 – 172AN → H in AAC83616 (PubMed:9839469).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0182911 – 65Missing in isoform MYB59-1. 2 PublicationsAdd BLAST65
Alternative sequenceiVSP_0182922 – 40KLVQE…VAKVS → GFCSESFRFEGGGRNIRI in isoform MYB59-2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_01829367 – 215Missing in isoform MYB59-4. 1 PublicationAdd BLAST149

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF062894 mRNA Translation: AAC83616.1
AY519641 mRNA Translation: AAS10111.1
DQ075252 mRNA Translation: AAY97894.1
DQ075253 mRNA Translation: AAY97895.1
DQ075254 mRNA Translation: AAY97896.1
AB006705 Genomic DNA Translation: BAB09515.1
CP002688 Genomic DNA Translation: AED97231.1
CP002688 Genomic DNA Translation: AED97232.1
CP002688 Genomic DNA Translation: AED97233.1
AK229048 mRNA Translation: BAF00931.1
Z95781 mRNA Translation: CAB09213.1
Z95772 mRNA Translation: CAB09204.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T51666

NCBI Reference Sequences

More...
RefSeqi
NP_200786.1, NM_125370.4 [Q4JL84-1]
NP_851225.1, NM_180894.4 [Q4JL84-2]
NP_851226.1, NM_180895.3 [Q4JL84-3]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT5G59780.1; AT5G59780.1; AT5G59780 [Q4JL84-2]
AT5G59780.2; AT5G59780.2; AT5G59780 [Q4JL84-3]
AT5G59780.3; AT5G59780.3; AT5G59780 [Q4JL84-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
836099

Gramene; a comparative resource for plants

More...
Gramenei
AT5G59780.1; AT5G59780.1; AT5G59780 [Q4JL84-2]
AT5G59780.2; AT5G59780.2; AT5G59780 [Q4JL84-3]
AT5G59780.3; AT5G59780.3; AT5G59780 [Q4JL84-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT5G59780

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062894 mRNA Translation: AAC83616.1
AY519641 mRNA Translation: AAS10111.1
DQ075252 mRNA Translation: AAY97894.1
DQ075253 mRNA Translation: AAY97895.1
DQ075254 mRNA Translation: AAY97896.1
AB006705 Genomic DNA Translation: BAB09515.1
CP002688 Genomic DNA Translation: AED97231.1
CP002688 Genomic DNA Translation: AED97232.1
CP002688 Genomic DNA Translation: AED97233.1
AK229048 mRNA Translation: BAF00931.1
Z95781 mRNA Translation: CAB09213.1
Z95772 mRNA Translation: CAB09204.1
PIRiT51666
RefSeqiNP_200786.1, NM_125370.4 [Q4JL84-1]
NP_851225.1, NM_180894.4 [Q4JL84-2]
NP_851226.1, NM_180895.3 [Q4JL84-3]

3D structure databases

SMRiQ4JL84
ModBaseiSearch...

Protein-protein interaction databases

STRINGi3702.AT5G59780.3

Proteomic databases

PaxDbiQ4JL84

Genome annotation databases

EnsemblPlantsiAT5G59780.1; AT5G59780.1; AT5G59780 [Q4JL84-2]
AT5G59780.2; AT5G59780.2; AT5G59780 [Q4JL84-3]
AT5G59780.3; AT5G59780.3; AT5G59780 [Q4JL84-1]
GeneIDi836099
GrameneiAT5G59780.1; AT5G59780.1; AT5G59780 [Q4JL84-2]
AT5G59780.2; AT5G59780.2; AT5G59780 [Q4JL84-3]
AT5G59780.3; AT5G59780.3; AT5G59780 [Q4JL84-1]
KEGGiath:AT5G59780

Organism-specific databases

AraportiAT5G59780
TAIRilocus:2174324 AT5G59780

Phylogenomic databases

eggNOGiKOG0048 Eukaryota
COG5147 LUCA
InParanoidiQ4JL84
KOiK09422
OMAiQEEHLVM
OrthoDBi1499244at2759
PhylomeDBiQ4JL84

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q4JL84

Gene expression databases

ExpressionAtlasiQ4JL84 baseline and differential
GenevisibleiQ4JL84 AT

Family and domain databases

CDDicd00167 SANT, 2 hits
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017930 Myb_dom
IPR001005 SANT/Myb
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 2 hits
SMARTiView protein in SMART
SM00717 SANT, 2 hits
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS51294 HTH_MYB, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYB59_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4JL84
Secondary accession number(s): O50069
, Q0WPL8, Q4JL85, Q4JL86, Q7DLH5, Q9FN86
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: December 11, 2019
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again