Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (03 Jul 2019)
Sequence version 1 (02 Aug 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tyrosine-protein phosphatase non-receptor type 20

Gene

PTPN20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei323SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei353Phosphocysteine intermediatePROSITE-ProRule annotation1
Binding sitei397SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-9008059 Interleukin-37 signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 20 (EC:3.1.3.48)
Short name:
hPTPN20
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTPN20Imported
Synonyms:PTPN20A, PTPN20BImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23423 PTPN20

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610630 gene
610631 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4JDL3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000204179

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134904835

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PTPN20

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121944218

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002957551 – 420Tyrosine-protein phosphatase non-receptor type 20Add BLAST420

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei76PhosphoserineBy similarity1
Modified residuei120PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4JDL3

PeptideAtlas

More...
PeptideAtlasi
Q4JDL3

PRoteomics IDEntifications database

More...
PRIDEi
Q4JDL3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62174
62175 [Q4JDL3-10]
62176 [Q4JDL3-11]
62177 [Q4JDL3-12]
62178 [Q4JDL3-13]
62179 [Q4JDL3-14]
62180 [Q4JDL3-15]
62181 [Q4JDL3-2]
62182 [Q4JDL3-3]
62183 [Q4JDL3-4]
62184 [Q4JDL3-5]
62185 [Q4JDL3-6]
62186 [Q4JDL3-7]
62187 [Q4JDL3-8]
62188 [Q4JDL3-9]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q4JDL3

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4JDL3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4JDL3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Present in many cell lines (at protein level). Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204179 Expressed in 164 organ(s), highest expression level in pons

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4JDL3 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043337
HPA046896
HPA048310

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117546, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q4JDL3, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000363459

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4JDL3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini159 – 412Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST254

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni353 – 359Substrate bindingBy similarity7

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0789 Eukaryota
COG5599 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160066

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4JDL3

KEGG Orthology (KO)

More...
KOi
K18039

Identification of Orthologs from Complete Genome Data

More...
OMAi
REQRYGM

Database of Orthologous Groups

More...
OrthoDBi
411281at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4JDL3

TreeFam database of animal gene trees

More...
TreeFami
TF315573

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029021 Prot-tyrosine_phosphatase-like
IPR000242 PTPase_domain
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR000387 TYR_PHOSPHATASE_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00102 Y_phosphatase, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00700 PRTYPHPHTASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00194 PTPc, 1 hit
SM00404 PTPc_motif, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50055 TYR_PHOSPHATASE_PTP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (15+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 15 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 15 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4JDL3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSPRDFRAE PVNDYEGNDS EAEDLNFRET LPSSSQENTP RSKVFENKVN
60 70 80 90 100
SEKVKLSLRN FPHNDYEDVF EEPSESGSDP SMWTARGPFR RDRWSSEDEE
110 120 130 140 150
AAGPSQALSP LLSDTRKIVS EGELDQLAQI RPLIFNFHEQ TAIKDCLKIL
160 170 180 190 200
EEKTAAYDIM QEFMALELKN LPGEFNSGNQ PSNREKNRYR DILPYDSTRV
210 220 230 240 250
PLGKSKDYIN ASYIRIVNCG EEYFYIATQG PLLSTIDDFW QMVLENNSNV
260 270 280 290 300
IAMITREIEG GIIKCYHYWP ISLKKPLELK HFRVFLENYQ ILQYFIIRMF
310 320 330 340 350
QVVEKSTGTS HSVKQLQFTK WPDHGTPASA DSFIKYIRYA RKSHLTGPMV
360 370 380 390 400
VHCSAGIGRT GVFLCVDVVF CAIVKNCSFN IMDIVAQMRE QRSGMVQTKE
410 420
QYHFCYDIVL EVLRKLLTLD
Length:420
Mass (Da):48,423
Last modified:August 2, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3A1C8041ACB710E
GO
Isoform 2 (identifier: Q4JDL3-2) [UniParc]FASTAAdd to basket
Also known as: Variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI

Show »
Length:411
Mass (Da):47,393
Checksum:i84315BC1463CF896
GO
Isoform 3 (identifier: Q4JDL3-3) [UniParc]FASTAAdd to basket
Also known as: Variant 10

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL

Show »
Length:392
Mass (Da):45,123
Checksum:i0117231EAC24C57B
GO
Isoform 4 (identifier: Q4JDL3-4) [UniParc]FASTAAdd to basket
Also known as: Variant 12

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Show »
Length:339
Mass (Da):39,184
Checksum:i33F1B10881A748C5
GO
Isoform 5 (identifier: Q4JDL3-5) [UniParc]FASTAAdd to basket
Also known as: Variant 13

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-306: Missing.

Show »
Length:197
Mass (Da):22,439
Checksum:i75CC97D2E52F5EE4
GO
Isoform 6 (identifier: Q4JDL3-6) [UniParc]FASTAAdd to basket
Also known as: Variant 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-192: Missing.
     193-195: LPY → MID

Show »
Length:228
Mass (Da):26,374
Checksum:i7A416A64EF1E9D8C
GO
Isoform 7 (identifier: Q4JDL3-7) [UniParc]FASTAAdd to basket
Also known as: Variant 7

The sequence of this isoform differs from the canonical sequence as follows:
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:226
Mass (Da):25,881
Checksum:i7E024F34E1952E10
GO
Isoform 8 (identifier: Q4JDL3-8) [UniParc]FASTAAdd to basket
Also known as: Variant 4

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:217
Mass (Da):24,851
Checksum:iC4F0BC493F07E554
GO
Isoform 9 (identifier: Q4JDL3-9) [UniParc]FASTAAdd to basket
Also known as: Variant 18

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-185: ALELKNLPGEFNSGNQPSNRE → MIQHAFLLEKARTTSMLVILE
     186-420: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:104
Mass (Da):11,999
Checksum:iDD927F235474DDB6
GO
Isoform 10 (identifier: Q4JDL3-10) [UniParc]FASTAAdd to basket
Also known as: Variant 8

The sequence of this isoform differs from the canonical sequence as follows:
     165-378: Missing.

Show »
Length:206
Mass (Da):23,869
Checksum:i3AE7C577FAE313F6
GO
Isoform 11 (identifier: Q4JDL3-11) [UniParc]FASTAAdd to basket
Also known as: Variant 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     165-306: Missing.

Show »
Length:269
Mass (Da):30,648
Checksum:i26C149800AABD0C2
GO
Isoform 12 (identifier: Q4JDL3-12) [UniParc]FASTAAdd to basket
Also known as: Variant 11

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:198
Mass (Da):22,581
Checksum:i3955399CCEBDEF4E
GO
Isoform 13 (identifier: Q4JDL3-13) [UniParc]FASTAAdd to basket
Also known as: Variant 9

The sequence of this isoform differs from the canonical sequence as follows:
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.

Show »
Length:145
Mass (Da):16,414
Checksum:iCE6E89C11FA531C9
GO
Isoform 14 (identifier: Q4JDL3-14) [UniParc]FASTAAdd to basket
Also known as: Variant 14

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:145
Mass (Da):16,643
Checksum:iD800415BBA550F7D
GO
Isoform 15 (identifier: Q4JDL3-15) [UniParc]FASTAAdd to basket
Also known as: Variant 5

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.

Show »
Length:136
Mass (Da):15,384
Checksum:iA29B5EC8F4DE0E89
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RC68D6RC68_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN20
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T1G4Q5T1G4_HUMAN
Protein tyrosine phosphatase, non-r...
PTPN20 PTPN20A, RP11-142I17.1-003
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q4JDK3Q4JDK3_HUMAN
Non-receptor protein tyrosine phosp...
PTPN20
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RF36D6RF36_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN20
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSU6A0A0A0MSU6_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN20
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAW28797 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0270631 – 192Missing in isoform 6. 1 PublicationAdd BLAST192
Alternative sequenceiVSP_0270641 – 81Missing in isoform 4, isoform 5, isoform 9 and isoform 14. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_0270651 – 43MSSPR…TPRSK → MGTTCLHLGTLEQSL in isoform 3 and isoform 12. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_0270661 – 11MSSPRDFRAEP → MI in isoform 2, isoform 8, isoform 11 and isoform 15. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_027067114 – 145DTRKI…TAIKD → VQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 13 and isoform 15. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027068146 – 420Missing in isoform 13 and isoform 15. 1 PublicationAdd BLAST275
Alternative sequenceiVSP_027069165 – 378Missing in isoform 10. 1 PublicationAdd BLAST214
Alternative sequenceiVSP_027070165 – 306Missing in isoform 5 and isoform 11. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_038003165 – 185ALELK…PSNRE → MIQHAFLLEKARTTSMLVIL E in isoform 9. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_038004186 – 420Missing in isoform 9. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_027071193 – 195LPY → MID in isoform 6. 1 Publication3
Alternative sequenceiVSP_027072195 – 226YDSTR…EYFYI → FQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 7, isoform 8, isoform 12 and isoform 14. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_027073227 – 420Missing in isoform 7, isoform 8, isoform 12 and isoform 14. 2 PublicationsAdd BLAST194

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY704141 mRNA Translation: AAW28780.1
AY704142 mRNA Translation: AAW28781.1
AY704143 mRNA Translation: AAW28782.1
AY704144 mRNA Translation: AAW28783.1
AY704145 mRNA Translation: AAW28784.1
AY704146 mRNA Translation: AAW28785.1
AY704147 mRNA Translation: AAW28786.1
AY704148 mRNA Translation: AAW28787.1
AY704149 mRNA Translation: AAW28788.1
AY704150 mRNA Translation: AAW28789.1
AY704151 mRNA Translation: AAW28790.1
AY704152 mRNA Translation: AAW28791.1
AY704153 mRNA Translation: AAW28792.1
AY704154 mRNA Translation: AAW28793.1
AY704158 mRNA Translation: AAW28797.1 Sequence problems.
AY753191 mRNA Translation: AAW88572.1
AL450334, AL672108 Genomic DNA Translation: CAI15685.1
AL358791, BX005072 Genomic DNA Translation: CAI14088.1
AL358791, BX005072 Genomic DNA Translation: CAI14090.1
AL672108, AL450334 Genomic DNA Translation: CAI12200.1
BX005072, AL358791 Genomic DNA Translation: CAI23640.1
BX005072, AL358791 Genomic DNA Translation: CAI23642.1
BC093750 mRNA Translation: AAH93750.1
BC113473 mRNA Translation: AAI13474.1
BC143394 mRNA Translation: AAI43395.1
BC171725 mRNA Translation: AAI71725.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73105.1 [Q4JDL3-2]
CCDS73106.1 [Q4JDL3-8]
CCDS73107.1 [Q4JDL3-11]
CCDS73108.1 [Q4JDL3-15]
CCDS73109.1 [Q4JDL3-6]
CCDS73110.1 [Q4JDL3-1]
CCDS73111.1 [Q4JDL3-7]
CCDS73114.1 [Q4JDL3-4]
CCDS73115.1 [Q4JDL3-14]
CCDS81454.1 [Q4JDL3-10]
CCDS81456.1 [Q4JDL3-5]
CCDS86087.1 [Q4JDL3-13]

NCBI Reference Sequences

More...
RefSeqi
NP_001035816.1, NM_001042357.4 [Q4JDL3-1]
NP_001035817.1, NM_001042358.4 [Q4JDL3-2]
NP_001035818.1, NM_001042359.3 [Q4JDL3-11]
NP_001035819.1, NM_001042360.3 [Q4JDL3-6]
NP_001035820.1, NM_001042361.4 [Q4JDL3-8]
NP_001035821.1, NM_001042362.3 [Q4JDL3-15]
NP_001035822.1, NM_001042363.4 [Q4JDL3-4]
NP_001035823.1, NM_001042364.4 [Q4JDL3-14]
NP_001307610.1, NM_001320681.1 [Q4JDL3-4]
NP_001307611.1, NM_001320682.1
NP_001307612.1, NM_001320683.1 [Q4JDL3-7]
NP_001307613.1, NM_001320684.1 [Q4JDL3-10]
NP_001307614.1, NM_001320685.1 [Q4JDL3-3]
NP_001307615.1, NM_001320686.1 [Q4JDL3-4]
NP_001307617.1, NM_001320688.1 [Q4JDL3-5]
NP_001307618.1, NM_001320689.1
NP_001307619.1, NM_001320690.1
NP_001307620.1, NM_001320691.1
NP_056420.3, NM_015605.8 [Q4JDL3-7]
XP_011537907.1, XM_011539605.2 [Q4JDL3-1]
XP_011537908.1, XM_011539606.2 [Q4JDL3-1]
XP_011537909.1, XM_011539607.2 [Q4JDL3-1]
XP_011537912.1, XM_011539610.2 [Q4JDL3-4]
XP_016871533.1, XM_017016044.1
XP_016871542.1, XM_017016053.1 [Q4JDL3-10]
XP_016871543.1, XM_017016054.1
XP_016871546.1, XM_017016057.1
XP_016871547.1, XM_017016058.1
XP_016871548.1, XM_017016059.1
XP_016871549.1, XM_017016060.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000374218; ENSP00000363335; ENSG00000204179 [Q4JDL3-4]
ENST00000374339; ENSP00000363459; ENSG00000204179 [Q4JDL3-1]
ENST00000374346; ENSP00000363466; ENSG00000204179 [Q4JDL3-7]
ENST00000395721; ENSP00000379071; ENSG00000204179 [Q4JDL3-4]
ENST00000395725; ENSP00000379075; ENSG00000204179 [Q4JDL3-14]
ENST00000395727; ENSP00000379077; ENSG00000204179 [Q4JDL3-6]
ENST00000502254; ENSP00000421404; ENSG00000204179 [Q4JDL3-13]
ENST00000502705; ENSP00000420995; ENSG00000204179 [Q4JDL3-10]
ENST00000503851; ENSP00000427676; ENSG00000204179 [Q4JDL3-15]
ENST00000505814; ENSP00000426355; ENSG00000204179 [Q4JDL3-4]
ENST00000506080; ENSP00000421921; ENSG00000204179 [Q4JDL3-4]
ENST00000508602; ENSP00000424491; ENSG00000204179 [Q4JDL3-14]
ENST00000509599; ENSP00000425012; ENSG00000204179 [Q4JDL3-7]
ENST00000509774; ENSP00000425362; ENSG00000204179 [Q4JDL3-8]
ENST00000509900; ENSP00000423819; ENSG00000204179 [Q4JDL3-14]
ENST00000510335; ENSP00000421453; ENSG00000204179 [Q4JDL3-9]
ENST00000511769; ENSP00000424283; ENSG00000204179 [Q4JDL3-2]
ENST00000513156; ENSP00000425912; ENSG00000204179 [Q4JDL3-11]
ENST00000513266; ENSP00000422839; ENSG00000204179 [Q4JDL3-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26095

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26095

UCSC genome browser

More...
UCSCi
uc001jdb.2 human [Q4JDL3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY704141 mRNA Translation: AAW28780.1
AY704142 mRNA Translation: AAW28781.1
AY704143 mRNA Translation: AAW28782.1
AY704144 mRNA Translation: AAW28783.1
AY704145 mRNA Translation: AAW28784.1
AY704146 mRNA Translation: AAW28785.1
AY704147 mRNA Translation: AAW28786.1
AY704148 mRNA Translation: AAW28787.1
AY704149 mRNA Translation: AAW28788.1
AY704150 mRNA Translation: AAW28789.1
AY704151 mRNA Translation: AAW28790.1
AY704152 mRNA Translation: AAW28791.1
AY704153 mRNA Translation: AAW28792.1
AY704154 mRNA Translation: AAW28793.1
AY704158 mRNA Translation: AAW28797.1 Sequence problems.
AY753191 mRNA Translation: AAW88572.1
AL450334, AL672108 Genomic DNA Translation: CAI15685.1
AL358791, BX005072 Genomic DNA Translation: CAI14088.1
AL358791, BX005072 Genomic DNA Translation: CAI14090.1
AL672108, AL450334 Genomic DNA Translation: CAI12200.1
BX005072, AL358791 Genomic DNA Translation: CAI23640.1
BX005072, AL358791 Genomic DNA Translation: CAI23642.1
BC093750 mRNA Translation: AAH93750.1
BC113473 mRNA Translation: AAI13474.1
BC143394 mRNA Translation: AAI43395.1
BC171725 mRNA Translation: AAI71725.1
CCDSiCCDS73105.1 [Q4JDL3-2]
CCDS73106.1 [Q4JDL3-8]
CCDS73107.1 [Q4JDL3-11]
CCDS73108.1 [Q4JDL3-15]
CCDS73109.1 [Q4JDL3-6]
CCDS73110.1 [Q4JDL3-1]
CCDS73111.1 [Q4JDL3-7]
CCDS73114.1 [Q4JDL3-4]
CCDS73115.1 [Q4JDL3-14]
CCDS81454.1 [Q4JDL3-10]
CCDS81456.1 [Q4JDL3-5]
CCDS86087.1 [Q4JDL3-13]
RefSeqiNP_001035816.1, NM_001042357.4 [Q4JDL3-1]
NP_001035817.1, NM_001042358.4 [Q4JDL3-2]
NP_001035818.1, NM_001042359.3 [Q4JDL3-11]
NP_001035819.1, NM_001042360.3 [Q4JDL3-6]
NP_001035820.1, NM_001042361.4 [Q4JDL3-8]
NP_001035821.1, NM_001042362.3 [Q4JDL3-15]
NP_001035822.1, NM_001042363.4 [Q4JDL3-4]
NP_001035823.1, NM_001042364.4 [Q4JDL3-14]
NP_001307610.1, NM_001320681.1 [Q4JDL3-4]
NP_001307611.1, NM_001320682.1
NP_001307612.1, NM_001320683.1 [Q4JDL3-7]
NP_001307613.1, NM_001320684.1 [Q4JDL3-10]
NP_001307614.1, NM_001320685.1 [Q4JDL3-3]
NP_001307615.1, NM_001320686.1 [Q4JDL3-4]
NP_001307617.1, NM_001320688.1 [Q4JDL3-5]
NP_001307618.1, NM_001320689.1
NP_001307619.1, NM_001320690.1
NP_001307620.1, NM_001320691.1
NP_056420.3, NM_015605.8 [Q4JDL3-7]
XP_011537907.1, XM_011539605.2 [Q4JDL3-1]
XP_011537908.1, XM_011539606.2 [Q4JDL3-1]
XP_011537909.1, XM_011539607.2 [Q4JDL3-1]
XP_011537912.1, XM_011539610.2 [Q4JDL3-4]
XP_016871533.1, XM_017016044.1
XP_016871542.1, XM_017016053.1 [Q4JDL3-10]
XP_016871543.1, XM_017016054.1
XP_016871546.1, XM_017016057.1
XP_016871547.1, XM_017016058.1
XP_016871548.1, XM_017016059.1
XP_016871549.1, XM_017016060.1

3D structure databases

SMRiQ4JDL3
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117546, 9 interactors
IntActiQ4JDL3, 1 interactor
STRINGi9606.ENSP00000363459

PTM databases

DEPODiQ4JDL3
iPTMnetiQ4JDL3
PhosphoSitePlusiQ4JDL3

Polymorphism and mutation databases

BioMutaiPTPN20
DMDMi121944218

Proteomic databases

PaxDbiQ4JDL3
PeptideAtlasiQ4JDL3
PRIDEiQ4JDL3
ProteomicsDBi62174
62175 [Q4JDL3-10]
62176 [Q4JDL3-11]
62177 [Q4JDL3-12]
62178 [Q4JDL3-13]
62179 [Q4JDL3-14]
62180 [Q4JDL3-15]
62181 [Q4JDL3-2]
62182 [Q4JDL3-3]
62183 [Q4JDL3-4]
62184 [Q4JDL3-5]
62185 [Q4JDL3-6]
62186 [Q4JDL3-7]
62187 [Q4JDL3-8]
62188 [Q4JDL3-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
26095
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374218; ENSP00000363335; ENSG00000204179 [Q4JDL3-4]
ENST00000374339; ENSP00000363459; ENSG00000204179 [Q4JDL3-1]
ENST00000374346; ENSP00000363466; ENSG00000204179 [Q4JDL3-7]
ENST00000395721; ENSP00000379071; ENSG00000204179 [Q4JDL3-4]
ENST00000395725; ENSP00000379075; ENSG00000204179 [Q4JDL3-14]
ENST00000395727; ENSP00000379077; ENSG00000204179 [Q4JDL3-6]
ENST00000502254; ENSP00000421404; ENSG00000204179 [Q4JDL3-13]
ENST00000502705; ENSP00000420995; ENSG00000204179 [Q4JDL3-10]
ENST00000503851; ENSP00000427676; ENSG00000204179 [Q4JDL3-15]
ENST00000505814; ENSP00000426355; ENSG00000204179 [Q4JDL3-4]
ENST00000506080; ENSP00000421921; ENSG00000204179 [Q4JDL3-4]
ENST00000508602; ENSP00000424491; ENSG00000204179 [Q4JDL3-14]
ENST00000509599; ENSP00000425012; ENSG00000204179 [Q4JDL3-7]
ENST00000509774; ENSP00000425362; ENSG00000204179 [Q4JDL3-8]
ENST00000509900; ENSP00000423819; ENSG00000204179 [Q4JDL3-14]
ENST00000510335; ENSP00000421453; ENSG00000204179 [Q4JDL3-9]
ENST00000511769; ENSP00000424283; ENSG00000204179 [Q4JDL3-2]
ENST00000513156; ENSP00000425912; ENSG00000204179 [Q4JDL3-11]
ENST00000513266; ENSP00000422839; ENSG00000204179 [Q4JDL3-5]
GeneIDi26095
KEGGihsa:26095
UCSCiuc001jdb.2 human [Q4JDL3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26095

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PTPN20
HGNCiHGNC:23423 PTPN20
HPAiHPA043337
HPA046896
HPA048310
MIMi610630 gene
610631 gene
neXtProtiNX_Q4JDL3
OpenTargetsiENSG00000204179
PharmGKBiPA134904835

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0789 Eukaryota
COG5599 LUCA
GeneTreeiENSGT00940000160066
InParanoidiQ4JDL3
KOiK18039
OMAiREQRYGM
OrthoDBi411281at2759
PhylomeDBiQ4JDL3
TreeFamiTF315573

Enzyme and pathway databases

ReactomeiR-HSA-9008059 Interleukin-37 signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PTPN20 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26095

Protein Ontology

More...
PROi
PR:Q4JDL3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204179 Expressed in 164 organ(s), highest expression level in pons
ExpressionAtlasiQ4JDL3 baseline and differential

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR029021 Prot-tyrosine_phosphatase-like
IPR000242 PTPase_domain
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR000387 TYR_PHOSPHATASE_dom
PfamiView protein in Pfam
PF00102 Y_phosphatase, 1 hit
PRINTSiPR00700 PRTYPHPHTASE
SMARTiView protein in SMART
SM00194 PTPc, 1 hit
SM00404 PTPc_motif, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50055 TYR_PHOSPHATASE_PTP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTN20_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4JDL3
Secondary accession number(s): A6NNH8
, B7ZKV3, Q4JDG6, Q4JDK1, Q4JDK5, Q4JDK6, Q4JDK8, Q4JDK9, Q4JDL0, Q4JDL1, Q4JDL4, Q4JDL5, Q4JDL6, Q4JDL7, Q4JDL8, Q5RJ33, Q5T1G3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: August 2, 2005
Last modified: July 3, 2019
This is version 119 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again