Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (08 May 2019)
Sequence version 3 (05 Apr 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Hydrocephalus-inducing protein homolog

Gene

HYDIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for ciliary motility.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hydrocephalus-inducing protein homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HYDIN
Synonyms:HYDIN1, KIAA1864
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19368 HYDIN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610812 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q4G0P3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Ciliary dyskinesia, primary, 5 (CILD5)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive form of primary dyskinesia, a disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. CILD5 is characterized by early onset of a progressive decline in lung function due to an inability to clear mucus and particles from the airways. Affected individuals have recurrent infections of the sinuses, ears, airways, and lungs. Sperm motility is also decreased. Individuals with CILD5 do not have situs inversus.
Related information in OMIM

Keywords - Diseasei

Ciliopathy, Kartagener syndrome, Primary ciliary dyskinesia

Organism-specific databases

DisGeNET

More...
DisGeNETi
54768

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
HYDIN

MalaCards human disease database

More...
MalaCardsi
HYDIN
MIMi608647 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000157423

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
244 Primary ciliary dyskinesia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134866950

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HYDIN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
327478578

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002848441 – 5121Hydrocephalus-inducing protein homologAdd BLAST5121

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q4G0P3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q4G0P3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q4G0P3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q4G0P3

PeptideAtlas

More...
PeptideAtlasi
Q4G0P3

PRoteomics IDEntifications database

More...
PRIDEi
Q4G0P3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
62119
62120 [Q4G0P3-2]
62121 [Q4G0P3-5]
62122 [Q4G0P3-6]
62123 [Q4G0P3-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q4G0P3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q4G0P3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157423 Expressed in 128 organ(s), highest expression level in bronchial epithelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q4G0P3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q4G0P3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA067155
HPA074129

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120142, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q4G0P3, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377197

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

15121
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q4G0P3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q4G0P3

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1908 – 1933Sequence analysisAdd BLAST26
Coiled coili2267 – 2365Sequence analysisAdd BLAST99
Coiled coili2504 – 2549Sequence analysisAdd BLAST46

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1975 – 1981Poly-Glu7

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IE17 Eukaryota
ENOG410XT7J LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00610000086095

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000171495

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q4G0P3

KEGG Orthology (KO)

More...
KOi
K17570

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQIQIAH

Database of Orthologous Groups

More...
OrthoDBi
3322at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q4G0P3

TreeFam database of animal gene trees

More...
TreeFami
TF340616

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 20 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031549 ASH
IPR033305 Hydin-like
IPR033768 Hydin_ADK
IPR013783 Ig-like_fold

The PANTHER Classification System

More...
PANTHERi
PTHR23053 PTHR23053, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15780 ASH, 1 hit
PF17213 Hydin_ADK, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q4G0P3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSRRLEESM GAVQMGLVNM FKGFQSKVLP PLSPKVVTEE EVNRMLTPSE
60 70 80 90 100
FLKEMSLTTE QRLAKTRLMC RPQIIELLDM GETTHQKFSG IDLDQALFQP
110 120 130 140 150
FPSEIIFQNY TPCEVYEVPL ILRNNDKIPR LVKVVEESSP YFKVISPKDI
160 170 180 190 200
GHKVAPGVPS IFRILFTPEE NKDYAHTLTC VTEREKFIVP IKARGARAIL
210 220 230 240 250
DFPDKLNFST CPVKYSTQKI LLVRNIGNKN AVFHIKTCRP FSIEPAIGTL
260 270 280 290 300
NVGESMQLEV EFEPQSVGDH SGRLIVCYDT GEKVFVSLYG AAIDMNIRLD
310 320 330 340 350
KNSLTIEKTY ISLANQRTIT IHNRSNIIAH FLWKVFATQQ EEDREKYRAC
360 370 380 390 400
DDLIKEEKDE TDEFFEECIT DPLLREHLSV LSRTFANQRR LVQGDSKLFF
410 420 430 440 450
NNVFTVEPLE GDVWPNSSAE ITVYFNPLEA KLYQQTIYCD ILGREIRLPL
460 470 480 490 500
RIKGEGMGPK IHFNFELLDI GKVFTGSAHC YEAILYNKGS IDALFNMTPP
510 520 530 540 550
TSALGACFVF SPKEGIIEPS GVQAIQISFS STILGNFEEE FLVNVNGSPE
560 570 580 590 600
PVKLTIRGCV IGPTFHFNVP ALHFGDVSFG FPHTLICSLN NTSLIPMTYK
610 620 630 640 650
LRIPGDGLGH KSISYCEQHV DYKRPSWTKE EISSMKPKEF TISPDCGTIR
660 670 680 690 700
PQGFAAIRVT LCSNTVQKYE LALVVDVEGI GEEVLALLIT ARCVVPALHL
710 720 730 740 750
VNTEVDFGHC FLKYPYEKTL QLANQDDLPG FYEVQPQVCE EVPTVLFSSP
760 770 780 790 800
TPSGVISPSS TIHIPLVLET QVTGEHRSTV YISIFGSQDP PLVCHLKSAG
810 820 830 840 850
EGPVIYVHPN QVDFGNIYVL KDSSRILNLC NQSFIPAFFQ AHMAHKKSLW
860 870 880 890 900
TIEPNEGMVP PETDVQLALT ANLNDTLTFK DCVILDIENS STYRIPVQAS
910 920 930 940 950
GTGSTIVSDK PFAPELNLGA HFSLDTHYYH FKLINKGRRI QQLFWMNDSF
960 970 980 990 1000
RPQAKLSKKG RVKKGHAHVQ PQPSGSQEPR DPQSPVFHLH PASMELYPGQ
1010 1020 1030 1040 1050
AIDVILEGYS ATPRIVKEKL VCHAIIGAQK GKSLVMAVNI TCEFVAPLIQ
1060 1070 1080 1090 1100
LSTKQLIYRL EKKPNSILKP DYQPLAIKNI STLPVNLLLS TSGPFFICET
1110 1120 1130 1140 1150
DKSLLPATPE PIKLEIDEEK NLLIKFDPSY RNDLNNWVAE EILAIKYVEH
1160 1170 1180 1190 1200
PQIDSLDLRG EVHYPNLSFE TKELDFGCIL NDTELIRYVT ITNCSPLVVK
1210 1220 1230 1240 1250
FRWFFLVNDE ENQIRFVTLP KKPYSAPVSQ MESIPATSEA ASPPAILVTV
1260 1270 1280 1290 1300
ESPEMDLNDF VKTVLVDEDA RPEEKELRKT KASSVISDEI KISSTEIERI
1310 1320 1330 1340 1350
YSSQSQVEDQ ESLQTCEQNE MLSIGIEEVF DILPLFGVLQ PHSSHQISFT
1360 1370 1380 1390 1400
FYGHANIIAQ AKALCEVEEG PTYEITLKGE ASLVNYSFDT KDIHYGLQLF
1410 1420 1430 1440 1450
DHVTEREITL TNMGKVGFEF KVLTDHQSSP DNLLPGVPLI LPVSGFISSH
1460 1470 1480 1490 1500
QEQVLKVYYL PGVPEVFKRS FQIQIAHLDP ENITLSGEGI FPQICLDLPR
1510 1520 1530 1540 1550
NLTANEKYEM FLNQARKNTD KEYNKCEMLD HFDIITEEVP EDEPAEVSAH
1560 1570 1580 1590 1600
LQMEVERLIV QSYVLEHQKT TTPDPMDDPC FSHRSRRKLA KIQLPEYILD
1610 1620 1630 1640 1650
FGYIILGEVR THIIKIINTS HFPVSFHADK RVLHETGFST ELDRVKNLPH
1660 1670 1680 1690 1700
CETEIFEVRF DPQGANLPVG SKEVILPIKV VGGPTVHICL QAKVTIPTMT
1710 1720 1730 1740 1750
LSRGKVDFAT IQCGQCLVET IQLSNHLQVP CEWFVQSQKP VDKLEKHMPK
1760 1770 1780 1790 1800
YLRQKLRAEL KPKTRIFEIQ PISGVLDPGE KSNVQVKFMP KEEKFYSQTL
1810 1820 1830 1840 1850
VFQIAQSAQK LTLLARGQGL EPRLEFSPSV LDLGPLLLCA PGDEAEVIVK
1860 1870 1880 1890 1900
NPCNFPIEFY SLEFDQQYLI EEKILRKLKG YDSYNTLLLP PRNPGEKLPP
1910 1920 1930 1940 1950
ELYEYFKEIK KSKEEQMRAK YLENLAQENE EEDITSSDQG TSNSTKRTSL
1960 1970 1980 1990 2000
SRGISVTSNL EEWHALLVES KTYLEEEEDE ESLEKIIFQT DKLQSIDSHS
2010 2020 2030 2040 2050
MEEVGEVENN PVSKAIARHL GIDISAEGRL AKNRKGIAII IHGTPLSGKS
2060 2070 2080 2090 2100
ANAVSVAKYY NAACLSIDSI VLEAVANSNN IPGIRARELC IRAAIEQSVK
2110 2120 2130 2140 2150
EGEEAAQEAA VGQNVIGQGR LSTDTLGKLA SEMTLVAPEI KPGKSVRGSV
2160 2170 2180 2190 2200
VITKSKADSH GSGSQKQHHS HQSETPQISS SPLPPGPIHR WLSVSPSVGG
2210 2220 2230 2240 2250
ETGLMSCVLP DELLVQILAE RIQLSDCYRG VVFDGLDTLF AQNAAAALLC
2260 2270 2280 2290 2300
LLKAIGSREH IYILNMAQDY AAMKAQEKAK KEQEERKHKG ALEKEKERLQ
2310 2320 2330 2340 2350
NMDEEEYDAL TEEEKLTFDR GIQQALRERK KREQERLAKE MQEKKLQQEL
2360 2370 2380 2390 2400
ERQKEEDELK RRVKKGKQGP IKEEPPMKKS QAANKQVPPL TKVDVKMETI
2410 2420 2430 2440 2450
ERKISVREQT MSEKEELNKK KRNMGDVSMH GLPLVQDQED SEGDNSKDPD
2460 2470 2480 2490 2500
KQLAPKFKTY ELTLKDVQNI LMYWDRKQGV QLPPAGMEEA PHEPDDQRQV
2510 2520 2530 2540 2550
PLGGRRGRKD RERERLEKER TEKERLEREK AERERLEKLR ALEERSDWEG
2560 2570 2580 2590 2600
EGEEDHEGKK EKDLGVPFLD IQTPDFEGLS WKQALESDKL PKGEQILDIL
2610 2620 2630 2640 2650
GLGASGPPIP PPALFSIVSY PVKRPPLTMT DDLEHFVFVI PPSEDISLDE
2660 2670 2680 2690 2700
KKEMEIESDF LATTNTTKAQ EEQTSSSKGG KQKMKEKIDQ VFEIQKDKRH
2710 2720 2730 2740 2750
MALNRKVLSG EPAGTISQLS DTDLDNFNGQ HSQEKFTRLN HFRWIVPANG
2760 2770 2780 2790 2800
EVTLQVHFSS DEFGNFDQTF NFEILGTCCQ YQLYCRGICT YPYICQDPKV
2810 2820 2830 2840 2850
VFPQRKMDMK TNEVIFKKYV MSTETYYFGP LLCGKSRDKY KSSLFPGNME
2860 2870 2880 2890 2900
TLTILNTSLM VVEASFYFQN DVKANTYFLE PNTMVLKPNE KQILNVWAYP
2910 2920 2930 2940 2950
TSVGVFEDSI VCCINDNPEP AIFQLSCQGI RPELELEPRQ LHFDRLLLHR
2960 2970 2980 2990 3000
QESRVVLLRN VTLLPVAWRI TSLEHLGDDF TVSLMQGTIP PEAEYGLHLY
3010 3020 3030 3040 3050
FQPTKPVNIK KAIRLEVLDA ENLLGVVQIE NIMVFAEAYD IALDITFPKG
3060 3070 3080 3090 3100
AEGGLDFGIV RVTEEAKQPL QLKNRGKYEI AFSFSVDSVG ISTPNINSMI
3110 3120 3130 3140 3150
SVQPKKGSLT PTEKPTNVQV FFHAKKEVKI EHQPVLRCQI IEPNISEGGE
3160 3170 3180 3190 3200
IIASIPIKFS ANAVYSKYNI TPSSVINFGA LICGTRKSTT FTIENQGVTD
3210 3220 3230 3240 3250
FKFALYKLTG ESPIHQKKAA SHVRHARSRE SESFYKTGSS RAAKFSDTIQ
3260 3270 3280 3290 3300
KEVTTTGQAR FAHGMFTVYP GFGSIPSGGQ QVINVDCVAD AMGKCEEFIA
3310 3320 3330 3340 3350
IDISGRDPAV HPAGILYTLL AEACLPAFVT ENNALIFEEH QICTSANLHH
3360 3370 3380 3390 3400
ILQTIESGGL FVEDENKFIF CNVLVGRQAK ARFKISNVGK ITCDVNIVVR
3410 3420 3430 3440 3450
PISNKPFARI VDIFEVEPSK MCIASHSHAF ATVSFTPQIM QNYQCIFEAT
3460 3470 3480 3490 3500
LDGLPSTLAK SRGLVFDIAG EGNLPRVTVV RPVLHNQYGN PLLLFKRLLL
3510 3520 3530 3540 3550
GHSEKLPLIL KNNGVLPAQL HVDLQDELGV FSLKGRPTTA YIYITEENKP
3560 3570 3580 3590 3600
HVKAKKAHTA SLVVSPGDTA EFDVVFHSQK VGRMRGIIHL SVINNQYEET
3610 3620 3630 3640 3650
SIHMVGEGYE DDITLDNIHG LVAPTSQEDI SISEFTEIIE DNDMEDLVAA
3660 3670 3680 3690 3700
ALVDHIQFGD CHIGHSYNAS FTVTNHSQVN LIRFEWPVSA TIAFSPQMGH
3710 3720 3730 3740 3750
LHPGCAKDIV VTMKSDVPIN LKNMRIRCKL SRIMFQLPAD QVPDWDDRMH
3760 3770 3780 3790 3800
TVKWVDVPRN MPGTFTTKRK VIETDPEPAH SVLEENYQEL QLQISANVDF
3810 3820 3830 3840 3850
ASYHCQARDV RFKETLVYQT RVFEFDVINS GRVQLEFSWV SEDTSKAVSF
3860 3870 3880 3890 3900
AKPDHQGSAQ KDQLSQGTMH TGSTLDSTMD HWAEGSPQPF SVEPSSGIVP
3910 3920 3930 3940 3950
VGKIQKFKVK FSPLDIGDFE SNLFCQIPNL PPGEQGPVLV AKGRSTLPIC
3960 3970 3980 3990 4000
HFDLKDSDYI SGHQRNPELR GSSGGALDPN TRVIEFTTVG IGGKNLRTFT
4010 4020 4030 4040 4050
ILNPTNSTYS FCWISEEIES LQNPAAFTCL TEKGFIHPEK KAEIVFQFTP
4060 4070 4080 4090 4100
FHLGITESSW TFLIPEHNIT VPFLLVGKTT EPLISLNKSH LNFSSLLIGR
4110 4120 4130 4140 4150
EARETVQIIN KEEQGFDFSF QDNSRYSEGF SNSLLVCPME GWIPPLSRFP
4160 4170 4180 4190 4200
IDIFFTPKQE GDVNFNLICN VEKKVHPVTL NVKAEGYTMN VEIKCKDRTG
4210 4220 4230 4240 4250
SITLLTPNQT NIINFYEVEL NECVQCEFNF INTGKFTFSF QAQLCGSKTL
4260 4270 4280 4290 4300
LQYLEFSPID STVDVGQSVH ATLSFQPLKK CVLTDLELII KISHGPTFMC
4310 4320 4330 4340 4350
NISGCAVSPA IHFSFTSYNF GTCFIYQAGM PPYKQTLVIT NKEETPMSID
4360 4370 4380 4390 4400
CLYTNTTHLE VNSRVDVVKP GNTLEIPITF YPRESINYQE LIPFEINGLS
4410 4420 4430 4440 4450
QQTVEIKGKG TKMKILVLDP ANRIVKLGAV LPGQVVKRTV SIMNNSLAQL
4460 4470 4480 4490 4500
TFNQSILFTI PELQEPKVLT LAPFHNITLK PKEVCKLEVI FAPKKRVPPF
4510 4520 4530 4540 4550
SEEVFMECMG LLRPLFLLSG CCQALEISLD QEHIPFGPVV YQTQATRRIL
4560 4570 4580 4590 4600
MMNTGDVGAR FKWDIKKFEP HFSISPEEGY ITSGMEVSFE VTYHPTEVGK
4610 4620 4630 4640 4650
ESLCKNILCY IQGGSPLSLT LSGVCVGPPA VKEVVNFTCQ VRSKHTQTIL
4660 4670 4680 4690 4700
LSNRTNQTWN LHPIFEGEHW EGPEFITLEA HQQNKPYEIT YRPRTMNLEN
4710 4720 4730 4740 4750
RKHQGTLFFP LPDGTGWLYA LHGTSELPKA VANIYREVPC KTPYTELLPI
4760 4770 4780 4790 4800
TNWLNKPQRF RVIVEILKPE KPDLSITMKG LDYIDVLSGS KKDYKLNFFS
4810 4820 4830 4840 4850
HKEGTYAAKV IFRNEVTNEF LYYNVSFRVI PSGIIKTIEM VTPVRQVASA
4860 4870 4880 4890 4900
SIKLENPLPY SVTFSTECRM PDIALPSQFV VPANSEGTFS FEFQPLKAGE
4910 4920 4930 4940 4950
TFGRLTLHNT DLGYYQYELY LKATPALPEK PVHFQTVLGS SQIILVKFIN
4960 4970 4980 4990 5000
YTRQRTEYYC RTDCTDFHAE KLINAAPGGQ GGTEASVEVL FEPSHLGETK
5010 5020 5030 5040 5050
GILILSSLAG GEYIIPLFGM ALPPKPQGPF SIRAGYSIII PFKNVFYHMV
5060 5070 5080 5090 5100
TFSIIVDNPA FTIRAGESVR PKKINNITVS FEGNPSGSKT PITTKLTVSC
5110 5120
PPGEGSETGV KWVYYLKGIT L
Length:5,121
Mass (Da):575,892
Last modified:April 5, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i47FB2A11C7E50A4F
GO
Isoform 2 (identifier: Q4G0P3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3823: Missing.
     3824-3824: E → M
     4887-5121: GTFSFEFQPL...WVYYLKGITL → RWGLTASSRLECSGMIIAPCSLKLLQSRPPPASAS

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,098
Mass (Da):123,076
Checksum:i253E0EF252881F8B
GO
Isoform 4 (identifier: Q4G0P3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1015-1017: IVK → VRG
     1018-5121: Missing.

Show »
Length:1,017
Mass (Da):114,208
Checksum:iB4AB03CA5302D5BB
GO
Isoform 5 (identifier: Q4G0P3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     693-708: CVVPALHLVNTEVDFG → YCSPACSSPESPPSLQ
     709-5121: Missing.

Show »
Length:708
Mass (Da):79,722
Checksum:i06C5B2713F7D7470
GO
Isoform 6 (identifier: Q4G0P3-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MESAGGFKLGMEPLSGGGVCEKKKLLKM
     923-923: S → R
     924-5121: Missing.

Note: No experimental confirmation available.
Show »
Length:950
Mass (Da):106,269
Checksum:i7236F8324AD317AF
GO
Isoform 7 (identifier: Q4G0P3-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MESAGGFKLGEKKKLLKM
     923-923: S → R
     924-5121: Missing.

Show »
Length:940
Mass (Da):105,338
Checksum:i5AE6895A825BACF8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QQJ7J3QQJ7_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
833Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WD03F8WD03_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
725Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YF91H0YF91_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QL79J3QL79_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
528Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTP9J3KTP9_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YH52H0YH52_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRJ6J3KRJ6_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVK9A0A087WVK9_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H8I6F5H8I6_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QL30J3QL30_HUMAN
Hydrocephalus-inducing protein homo...
HYDIN
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH28351 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB15527 differs from that shown. Reason: Frameshift at position 4804.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti299L → P in BAB14314 (PubMed:14702039).Curated1
Sequence conflicti313L → M in AAH28351 (PubMed:15489334).Curated1
Sequence conflicti460K → T in BAB14314 (PubMed:14702039).Curated1
Sequence conflicti532T → I in AAH28351 (PubMed:15489334).Curated1
Sequence conflicti584T → I in BAG61096 (PubMed:14702039).Curated1
Sequence conflicti881D → N in BAG61096 (PubMed:14702039).Curated1
Sequence conflicti3945S → N in AAH43273 (PubMed:15489334).Curated1
Sequence conflicti4663P → T in AAH43273 (PubMed:15489334).Curated1
Sequence conflicti4667G → V in BAB15527 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031837451R → P. Corresponds to variant dbSNP:rs7200485Ensembl.1
Natural variantiVAR_031838584T → N. Corresponds to variant dbSNP:rs7200126Ensembl.1
Natural variantiVAR_031839690T → A. Corresponds to variant dbSNP:rs10744982Ensembl.1
Natural variantiVAR_031840724N → D. Corresponds to variant dbSNP:rs3817211Ensembl.1
Natural variantiVAR_0596671077I → V. Corresponds to variant dbSNP:rs6416709Ensembl.1
Natural variantiVAR_0596681228V → L. Corresponds to variant dbSNP:rs1774513Ensembl.1
Natural variantiVAR_0596691534I → V. Corresponds to variant dbSNP:rs1774303Ensembl.1
Natural variantiVAR_0510361718V → M. Corresponds to variant dbSNP:rs783762Ensembl.1
Natural variantiVAR_0510371892R → H. Corresponds to variant dbSNP:rs783732Ensembl.1
Natural variantiVAR_0510381952R → Q. Corresponds to variant dbSNP:rs17321570Ensembl.1
Natural variantiVAR_0596702087R → C. Corresponds to variant dbSNP:rs1774541Ensembl.1
Natural variantiVAR_0510392099V → M. Corresponds to variant dbSNP:rs1798337Ensembl.1
Natural variantiVAR_0596712242Q → R. Corresponds to variant dbSNP:rs2258307Ensembl.1
Natural variantiVAR_0510402276Q → R. Corresponds to variant dbSNP:rs1815707Ensembl.1
Natural variantiVAR_0596722298R → G. Corresponds to variant dbSNP:rs1774360Ensembl.1
Natural variantiVAR_0510412306E → G. Corresponds to variant dbSNP:rs2502726EnsemblClinVar.1
Natural variantiVAR_0510422445N → I. Corresponds to variant dbSNP:rs1798532Ensembl.1
Natural variantiVAR_0616662455P → Q. Corresponds to variant dbSNP:rs1798531EnsemblClinVar.1
Natural variantiVAR_0510432502L → S. Corresponds to variant dbSNP:rs1798529Ensembl.1
Natural variantiVAR_0596732530K → E. Corresponds to variant dbSNP:rs1798528Ensembl.1
Natural variantiVAR_0510442558G → E. Corresponds to variant dbSNP:rs8044142Ensembl.1
Natural variantiVAR_0596742570D → N. Corresponds to variant dbSNP:rs8044001Ensembl.1
Natural variantiVAR_0510452589K → R. Corresponds to variant dbSNP:rs1774395Ensembl.1
Natural variantiVAR_0596752694I → S. Corresponds to variant dbSNP:rs1774449Ensembl.1
Natural variantiVAR_0510462932P → L. Corresponds to variant dbSNP:rs11075812Ensembl.1
Natural variantiVAR_0510472937E → K. Corresponds to variant dbSNP:rs8047935Ensembl.1
Natural variantiVAR_0510482939R → K. Corresponds to variant dbSNP:rs7188837Ensembl.1
Natural variantiVAR_0510492994E → G. Corresponds to variant dbSNP:rs12102425Ensembl.1
Natural variantiVAR_0510503116T → R. Corresponds to variant dbSNP:rs1774423Ensembl.1
Natural variantiVAR_0510513269Y → D. Corresponds to variant dbSNP:rs7197263Ensembl.1
Natural variantiVAR_0596763291A → P. Corresponds to variant dbSNP:rs1798440Ensembl.1
Natural variantiVAR_0596773316L → P. Corresponds to variant dbSNP:rs1774331Ensembl.1
Natural variantiVAR_0596783739A → T. Corresponds to variant dbSNP:rs1774504Ensembl.1
Natural variantiVAR_0596793742V → I. Corresponds to variant dbSNP:rs1798413Ensembl.1
Natural variantiVAR_0510523811R → H. Corresponds to variant dbSNP:rs13338821Ensembl.1
Natural variantiVAR_0596803840V → L. Corresponds to variant dbSNP:rs1798325Ensembl.1
Natural variantiVAR_0596813869M → R. Corresponds to variant dbSNP:rs7192347Ensembl.1
Natural variantiVAR_0510533899V → M. Corresponds to variant dbSNP:rs1626593Ensembl.1
Natural variantiVAR_0596824005T → A. Corresponds to variant dbSNP:rs1539302Ensembl.1
Natural variantiVAR_0510544026A → T. Corresponds to variant dbSNP:rs11075798Ensembl.1
Natural variantiVAR_0510554088K → R. Corresponds to variant dbSNP:rs1774416Ensembl.1
Natural variantiVAR_0596834160E → Q. Corresponds to variant dbSNP:rs1798314Ensembl.1
Natural variantiVAR_0510564270H → Y. Corresponds to variant dbSNP:rs1891343Ensembl.1
Natural variantiVAR_0596844363S → C. Corresponds to variant dbSNP:rs1770434Ensembl.1
Natural variantiVAR_0596854412K → E. Corresponds to variant dbSNP:rs1774480Ensembl.1
Natural variantiVAR_0596864552M → L. Corresponds to variant dbSNP:rs1770442Ensembl.1
Natural variantiVAR_0510584606N → K. Corresponds to variant dbSNP:rs783898Ensembl.1
Natural variantiVAR_0596874869R → Q. Corresponds to variant dbSNP:rs2795652Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0246841 – 3823Missing in isoform 2. 1 PublicationAdd BLAST3823
Alternative sequenceiVSP_0426921M → MESAGGFKLGMEPLSGGGVC EKKKLLKM in isoform 6. 1 Publication1
Alternative sequenceiVSP_0468181M → MESAGGFKLGEKKKLLKM in isoform 7. 1 Publication1
Alternative sequenceiVSP_024687693 – 708CVVPA…EVDFG → YCSPACSSPESPPSLQ in isoform 5. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_024688709 – 5121Missing in isoform 5. 1 PublicationAdd BLAST4413
Alternative sequenceiVSP_042693923S → R in isoform 6 and isoform 7. 1 Publication1
Alternative sequenceiVSP_042694924 – 5121Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST4198
Alternative sequenceiVSP_0246911015 – 1017IVK → VRG in isoform 4. 2 Publications3
Alternative sequenceiVSP_0246921018 – 5121Missing in isoform 4. 2 PublicationsAdd BLAST4104
Alternative sequenceiVSP_0246973824E → M in isoform 2. 1 Publication1
Alternative sequenceiVSP_0246984887 – 5121GTFSF…KGITL → RWGLTASSRLECSGMIIAPC SLKLLQSRPPPASAS in isoform 2. 1 PublicationAdd BLAST235

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK022933 mRNA Translation: BAB14314.1
AK026688 mRNA Translation: BAB15527.1 Frameshift.
AK299016 mRNA Translation: BAG61096.1
AK299348 mRNA Translation: BAG61346.1
AC027281 Genomic DNA No translation available.
AC099495 Genomic DNA No translation available.
AC138625 Genomic DNA No translation available.
BC028351 mRNA Translation: AAH28351.2 Different initiation.
BC043273 mRNA Translation: AAH43273.1
AL122038 mRNA Translation: CAB59178.1
AL133042 mRNA Translation: CAB61370.1
AL137259 mRNA Translation: CAB70660.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10897.1 [Q4G0P3-5]
CCDS56004.1 [Q4G0P3-8]
CCDS56005.1 [Q4G0P3-10]
CCDS59269.1 [Q4G0P3-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T42699
T46330

NCBI Reference Sequences

More...
RefSeqi
NP_001185471.1, NM_001198542.1 [Q4G0P3-8]
NP_001185472.1, NM_001198543.1 [Q4G0P3-10]
NP_001257903.1, NM_001270974.2 [Q4G0P3-1]
NP_060028.2, NM_017558.4 [Q4G0P3-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000321489; ENSP00000314736; ENSG00000157423 [Q4G0P3-5]
ENST00000393567; ENSP00000377197; ENSG00000157423 [Q4G0P3-1]
ENST00000538248; ENSP00000444970; ENSG00000157423 [Q4G0P3-8]
ENST00000541601; ENSP00000437341; ENSG00000157423 [Q4G0P3-10]
ENST00000634268; ENSP00000489181; ENSG00000283022 [Q4G0P3-8]
ENST00000634392; ENSP00000489221; ENSG00000283022 [Q4G0P3-10]
ENST00000634745; ENSP00000489246; ENSG00000283022 [Q4G0P3-5]
ENST00000635381; ENSP00000489526; ENSG00000283022 [Q4G0P3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54768

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54768

UCSC genome browser

More...
UCSCi
uc010vmc.3 human [Q4G0P3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022933 mRNA Translation: BAB14314.1
AK026688 mRNA Translation: BAB15527.1 Frameshift.
AK299016 mRNA Translation: BAG61096.1
AK299348 mRNA Translation: BAG61346.1
AC027281 Genomic DNA No translation available.
AC099495 Genomic DNA No translation available.
AC138625 Genomic DNA No translation available.
BC028351 mRNA Translation: AAH28351.2 Different initiation.
BC043273 mRNA Translation: AAH43273.1
AL122038 mRNA Translation: CAB59178.1
AL133042 mRNA Translation: CAB61370.1
AL137259 mRNA Translation: CAB70660.1
CCDSiCCDS10897.1 [Q4G0P3-5]
CCDS56004.1 [Q4G0P3-8]
CCDS56005.1 [Q4G0P3-10]
CCDS59269.1 [Q4G0P3-1]
PIRiT42699
T46330
RefSeqiNP_001185471.1, NM_001198542.1 [Q4G0P3-8]
NP_001185472.1, NM_001198543.1 [Q4G0P3-10]
NP_001257903.1, NM_001270974.2 [Q4G0P3-1]
NP_060028.2, NM_017558.4 [Q4G0P3-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E6JNMR-A459-563[»]
2YS4NMR-A182-296[»]
SMRiQ4G0P3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120142, 5 interactors
IntActiQ4G0P3, 3 interactors
STRINGi9606.ENSP00000377197

PTM databases

iPTMnetiQ4G0P3
PhosphoSitePlusiQ4G0P3

Polymorphism and mutation databases

BioMutaiHYDIN
DMDMi327478578

Proteomic databases

EPDiQ4G0P3
jPOSTiQ4G0P3
MaxQBiQ4G0P3
PaxDbiQ4G0P3
PeptideAtlasiQ4G0P3
PRIDEiQ4G0P3
ProteomicsDBi62119
62120 [Q4G0P3-2]
62121 [Q4G0P3-5]
62122 [Q4G0P3-6]
62123 [Q4G0P3-8]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321489; ENSP00000314736; ENSG00000157423 [Q4G0P3-5]
ENST00000393567; ENSP00000377197; ENSG00000157423 [Q4G0P3-1]
ENST00000538248; ENSP00000444970; ENSG00000157423 [Q4G0P3-8]
ENST00000541601; ENSP00000437341; ENSG00000157423 [Q4G0P3-10]
ENST00000634268; ENSP00000489181; ENSG00000283022 [Q4G0P3-8]
ENST00000634392; ENSP00000489221; ENSG00000283022 [Q4G0P3-10]
ENST00000634745; ENSP00000489246; ENSG00000283022 [Q4G0P3-5]
ENST00000635381; ENSP00000489526; ENSG00000283022 [Q4G0P3-1]
GeneIDi54768
KEGGihsa:54768
UCSCiuc010vmc.3 human [Q4G0P3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54768
DisGeNETi54768

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HYDIN
GeneReviewsiHYDIN

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0021241
HIX0161592
HGNCiHGNC:19368 HYDIN
HPAiHPA067155
HPA074129
MalaCardsiHYDIN
MIMi608647 phenotype
610812 gene
neXtProtiNX_Q4G0P3
OpenTargetsiENSG00000157423
Orphaneti244 Primary ciliary dyskinesia
PharmGKBiPA134866950

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IE17 Eukaryota
ENOG410XT7J LUCA
GeneTreeiENSGT00610000086095
HOGENOMiHOG000171495
InParanoidiQ4G0P3
KOiK17570
OMAiFQIQIAH
OrthoDBi3322at2759
PhylomeDBiQ4G0P3
TreeFamiTF340616

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HYDIN human
EvolutionaryTraceiQ4G0P3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54768

Protein Ontology

More...
PROi
PR:Q4G0P3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157423 Expressed in 128 organ(s), highest expression level in bronchial epithelial cell
ExpressionAtlasiQ4G0P3 baseline and differential
GenevisibleiQ4G0P3 HS

Family and domain databases

Gene3Di2.60.40.10, 20 hits
InterProiView protein in InterPro
IPR031549 ASH
IPR033305 Hydin-like
IPR033768 Hydin_ADK
IPR013783 Ig-like_fold
PANTHERiPTHR23053 PTHR23053, 1 hit
PfamiView protein in Pfam
PF15780 ASH, 1 hit
PF17213 Hydin_ADK, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHYDIN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q4G0P3
Secondary accession number(s): A6NC70
, A6NLZ0, B4DQY4, B4DRN4, F5H6V3, Q8N3H8, Q8N3P6, Q8TC08, Q96JG3, Q96SS4, Q9H5U3, Q9H9B8, Q9NTI0, Q9UBE5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 5, 2011
Last modified: May 8, 2019
This is version 132 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again