Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (11 Dec 2019)
Sequence version 1 (13 Sep 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ceramide kinase-like protein

Gene

CERKL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has no detectable ceramide-kinase activity. Overexpression of CERKL protects cells from apoptosis in oxidative stress conditions.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • negative regulation of apoptotic process Source: UniProtKB
  • sphingolipid biosynthetic process Source: Ensembl

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ceramide kinase-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CERKL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000188452.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21699 CERKL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608381 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q49MI3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Retinitis pigmentosa 26 (RP26)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_065182106R → S in RP26. 1 PublicationCorresponds to variant dbSNP:rs569826109EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi104 – 106KRR → GGG: Only cytoplasmic. 1 Publication3
Mutagenesisi260G → D: Loss of nuclear localization; in isoform 2. 1 Publication1

Keywords - Diseasei

Disease mutation, Retinitis pigmentosa

Organism-specific databases

DisGeNET

More...
DisGeNETi
375298

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
CERKL

MalaCards human disease database

More...
MalaCardsi
CERKL
MIMi608380 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000188452

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
791 Retinitis pigmentosa

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134984780

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q49MI3 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CERKL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
84028814

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001813561 – 558Ceramide kinase-like proteinAdd BLAST558

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine residues.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q49MI3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q49MI3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q49MI3

PeptideAtlas

More...
PeptideAtlasi
Q49MI3

PRoteomics IDEntifications database

More...
PRIDEi
Q49MI3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62075 [Q49MI3-1]
62076 [Q49MI3-2]
62077 [Q49MI3-3]
62078 [Q49MI3-4]
62079 [Q49MI3-5]
62080 [Q49MI3-7]
62081 [Q49MI3-8]
62082 [Q49MI3-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q49MI3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q49MI3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are expressed in adult retina, liver and pancreas as well as in fetal brain, lung and kidney. Isoform 3 is expressed in adult retina as well as in fetal lung and liver. Isoform 4 is expressed in adult retina, lung and kidney as well as in fetal lung and liver. Moderately expressed in retina, kidney, lung, testis, trachea, and pancreas. Weakly expressed in brain, placenta and liver.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal lung, kidney and brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188452 Expressed in 89 organ(s), highest expression level in leukocyte

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035443
HPA035444
HPA043203

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
131968, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q49MI3, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341159

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q49MI3 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini164 – 339DAGKcPROSITE-ProRule annotationAdd BLAST176

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi2 – 9Nuclear localization signal 1Sequence analysis8
Motifi102 – 106Nuclear localization signal 25

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1115 Eukaryota
KOG1116 Eukaryota
COG1597 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157578

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231784

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q49MI3

KEGG Orthology (KO)

More...
KOi
K19602

Identification of Orthologs from Complete Genome Data

More...
OMAi
SVMKECK

Database of Orthologous Groups

More...
OrthoDBi
681139at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q49MI3

TreeFam database of animal gene trees

More...
TreeFami
TF314514

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.10330, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017438 ATP-NAD_kinase_N
IPR001206 Diacylglycerol_kinase_cat_dom
IPR016064 NAD/diacylglycerol_kinase_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00781 DAGK_cat, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111331 SSF111331, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50146 DAGK, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q49MI3-1) [UniParc]FASTAAdd to basket
Also known as: b

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPWRRRRNRV SALEGGREEE APPEAAAVPP ALLTSPQQTE AAAERILLRG
60 70 80 90 100
IFEIGRDSCD VVLSERALRW RPIQPERPAG DSKYDLLCKE EFIELKDIFS
110 120 130 140 150
VKLKRRCSVK QQRSGTLLGI TLFICLKKEQ NKLKNSTLDL INLSEDHCDI
160 170 180 190 200
WFRQFKKILA GFPNRPKSLK ILLNPQSHKK EATQVYYEKV EPLLKLAGIK
210 220 230 240 250
TDVTIMEYEG HALSLLKECE LQGFDGGHRK PLFAIHWSVQ RLFTGMQTLE
260 270 280 290 300
PSVVCVGGDG SASEVAHALL LRAQKNAGME TDRILTPVRA QLPLGLIPAG
310 320 330 340 350
STNVLAHSLH GVPHVITATL HIIMGHVQLV DVCTFSTAGK LLRFGFSAMF
360 370 380 390 400
GFGGRTLALA EKYRWMSPNQ RRDFAVVKAL AKLKAEDCEI SFLPFNSSDD
410 420 430 440 450
VQERRAQGSP KSDCNDQWQM IQGQFLNVSI MAIPCLCSVA PRGLAPNTRL
460 470 480 490 500
NNGSMALIIA RNTSRPEFIK HLKRYASVKN QFNFPFVETY TVEEVKVHPR
510 520 530 540 550
NNTGGYNPEE EEDETASENC FPWNVDGDLM EVASEVHIRL HPRLISLYGG

SMEEMIPK
Length:558
Mass (Da):62,622
Last modified:September 13, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i305B6BB82CE977CB
GO
Isoform 2 (identifier: Q49MI3-2) [UniParc]FASTAAdd to basket
Also known as: a

The sequence of this isoform differs from the canonical sequence as follows:
     227-252: Missing.

Show »
Length:532
Mass (Da):59,603
Checksum:iC73E590F7C25EED1
GO
Isoform 3 (identifier: Q49MI3-3) [UniParc]FASTAAdd to basket
Also known as: d

The sequence of this isoform differs from the canonical sequence as follows:
     205-300: IMEYEGHALS...QLPLGLIPAG → R

Show »
Length:463
Mass (Da):52,445
Checksum:i36F0E7DC8396890A
GO
Isoform 4 (identifier: Q49MI3-4) [UniParc]FASTAAdd to basket
Also known as: c

The sequence of this isoform differs from the canonical sequence as follows:
     160-298: Missing.

Show »
Length:419
Mass (Da):47,370
Checksum:i26CAF6FA94820DF0
GO
Isoform 5 (identifier: Q49MI3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-252: Missing.
     405-558: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:378
Mass (Da):42,209
Checksum:i2372D50CA3BA00EA
GO
Isoform 7 (identifier: Q49MI3-7) [UniParc]FASTAAdd to basket
Also known as: f

The sequence of this isoform differs from the canonical sequence as follows:
     205-217: IMEYEGHALSLLK → MLSVLVEMDLLAK
     218-558: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:217
Mass (Da):24,836
Checksum:iCA3A37FC7F29CF7A
GO
Isoform 8 (identifier: Q49MI3-8) [UniParc]FASTAAdd to basket
Also known as: e

The sequence of this isoform differs from the canonical sequence as follows:
     161-173: GFPNRPKSLKILL → VLSVLVEMDLLAK
     174-558: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:173
Mass (Da):19,828
Checksum:i184DD8A7AF71BF41
GO
Isoform 9 (identifier: Q49MI3-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-205: GFPNRPKSLKILLNPQSHKKEATQVYYEKVEPLLKLAGIKTDVTI → V

Show »
Length:514
Mass (Da):57,632
Checksum:i012117C9A56696B1
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC85266 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence CAG26980 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti129E → D in CAG26980 (PubMed:15708351).Curated1
Sequence conflicti178H → R in CAG26978 (PubMed:15708351).Curated1
Sequence conflicti210G → E in CAG26977 (PubMed:15708351).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_065182106R → S in RP26. 1 PublicationCorresponds to variant dbSNP:rs569826109EnsemblClinVar.1
Natural variantiVAR_053688232L → F. Corresponds to variant dbSNP:rs10185262Ensembl.1
Natural variantiVAR_053689514E → G. Corresponds to variant dbSNP:rs35955809Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_016653160 – 298Missing in isoform 4. 1 PublicationAdd BLAST139
Alternative sequenceiVSP_042663161 – 205GFPNR…TDVTI → V in isoform 9. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_016654161 – 173GFPNR…LKILL → VLSVLVEMDLLAK in isoform 8. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_016655174 – 558Missing in isoform 8. 2 PublicationsAdd BLAST385
Alternative sequenceiVSP_016656205 – 300IMEYE…LIPAG → R in isoform 3. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_016657205 – 217IMEYE…LSLLK → MLSVLVEMDLLAK in isoform 7. 3 PublicationsAdd BLAST13
Alternative sequenceiVSP_016658218 – 558Missing in isoform 7. 3 PublicationsAdd BLAST341
Alternative sequenceiVSP_016659227 – 252Missing in isoform 2 and isoform 5. 3 PublicationsAdd BLAST26
Alternative sequenceiVSP_016660405 – 558Missing in isoform 5. 1 PublicationAdd BLAST154

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY357073 mRNA Translation: AAR13670.1
AY690329 mRNA Translation: AAW47988.1
AY690330 mRNA Translation: AAW47989.1
AY690331 mRNA Translation: AAW47990.1
AY690332 mRNA Translation: AAW47991.1
AY690333 mRNA Translation: AAW47992.1
AJ640141 mRNA Translation: CAG26695.1
AJ697855 mRNA Translation: CAG26977.1
AJ697856 mRNA Translation: CAG26978.1
AJ697858 mRNA Translation: CAG26980.1 Frameshift.
AK129976 mRNA Translation: BAC85266.1 Sequence problems.
AK293844 mRNA Translation: BAG57242.1
AC013733 Genomic DNA No translation available.
AC020595 Genomic DNA No translation available.
BC137498 mRNA Translation: AAI37499.1
BC137499 mRNA Translation: AAI37500.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33340.1 [Q49MI3-4]
CCDS33341.1 [Q49MI3-3]
CCDS42789.1 [Q49MI3-1]
CCDS46466.1 [Q49MI3-2]
CCDS54425.1 [Q49MI3-9]

NCBI Reference Sequences

More...
RefSeqi
NP_001025482.1, NM_001030311.2 [Q49MI3-1]
NP_001025483.1, NM_001030312.2 [Q49MI3-4]
NP_001025484.1, NM_001030313.2 [Q49MI3-3]
NP_001153749.1, NM_001160277.1 [Q49MI3-9]
NP_963842.1, NM_201548.4 [Q49MI3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339098; ENSP00000341159; ENSG00000188452 [Q49MI3-1]
ENST00000374967; ENSP00000364106; ENSG00000188452 [Q49MI3-7]
ENST00000374969; ENSP00000364108; ENSG00000188452 [Q49MI3-4]
ENST00000374970; ENSP00000364109; ENSG00000188452 [Q49MI3-3]
ENST00000409440; ENSP00000387080; ENSG00000188452 [Q49MI3-9]
ENST00000410087; ENSP00000386725; ENSG00000188452 [Q49MI3-2]
ENST00000421817; ENSP00000411466; ENSG00000188452 [Q49MI3-8]
ENST00000452174; ENSP00000409198; ENSG00000188452 [Q49MI3-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
375298

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:375298

UCSC genome browser

More...
UCSCi
uc002unx.4 human [Q49MI3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY357073 mRNA Translation: AAR13670.1
AY690329 mRNA Translation: AAW47988.1
AY690330 mRNA Translation: AAW47989.1
AY690331 mRNA Translation: AAW47990.1
AY690332 mRNA Translation: AAW47991.1
AY690333 mRNA Translation: AAW47992.1
AJ640141 mRNA Translation: CAG26695.1
AJ697855 mRNA Translation: CAG26977.1
AJ697856 mRNA Translation: CAG26978.1
AJ697858 mRNA Translation: CAG26980.1 Frameshift.
AK129976 mRNA Translation: BAC85266.1 Sequence problems.
AK293844 mRNA Translation: BAG57242.1
AC013733 Genomic DNA No translation available.
AC020595 Genomic DNA No translation available.
BC137498 mRNA Translation: AAI37499.1
BC137499 mRNA Translation: AAI37500.1
CCDSiCCDS33340.1 [Q49MI3-4]
CCDS33341.1 [Q49MI3-3]
CCDS42789.1 [Q49MI3-1]
CCDS46466.1 [Q49MI3-2]
CCDS54425.1 [Q49MI3-9]
RefSeqiNP_001025482.1, NM_001030311.2 [Q49MI3-1]
NP_001025483.1, NM_001030312.2 [Q49MI3-4]
NP_001025484.1, NM_001030313.2 [Q49MI3-3]
NP_001153749.1, NM_001160277.1 [Q49MI3-9]
NP_963842.1, NM_201548.4 [Q49MI3-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi131968, 11 interactors
IntActiQ49MI3, 9 interactors
STRINGi9606.ENSP00000341159

PTM databases

iPTMnetiQ49MI3
PhosphoSitePlusiQ49MI3

Polymorphism and mutation databases

BioMutaiCERKL
DMDMi84028814

Proteomic databases

jPOSTiQ49MI3
MassIVEiQ49MI3
PaxDbiQ49MI3
PeptideAtlasiQ49MI3
PRIDEiQ49MI3
ProteomicsDBi62075 [Q49MI3-1]
62076 [Q49MI3-2]
62077 [Q49MI3-3]
62078 [Q49MI3-4]
62079 [Q49MI3-5]
62080 [Q49MI3-7]
62081 [Q49MI3-8]
62082 [Q49MI3-9]

Genome annotation databases

EnsembliENST00000339098; ENSP00000341159; ENSG00000188452 [Q49MI3-1]
ENST00000374967; ENSP00000364106; ENSG00000188452 [Q49MI3-7]
ENST00000374969; ENSP00000364108; ENSG00000188452 [Q49MI3-4]
ENST00000374970; ENSP00000364109; ENSG00000188452 [Q49MI3-3]
ENST00000409440; ENSP00000387080; ENSG00000188452 [Q49MI3-9]
ENST00000410087; ENSP00000386725; ENSG00000188452 [Q49MI3-2]
ENST00000421817; ENSP00000411466; ENSG00000188452 [Q49MI3-8]
ENST00000452174; ENSP00000409198; ENSG00000188452 [Q49MI3-8]
GeneIDi375298
KEGGihsa:375298
UCSCiuc002unx.4 human [Q49MI3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
375298
DisGeNETi375298
EuPathDBiHostDB:ENSG00000188452.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CERKL
GeneReviewsiCERKL
HGNCiHGNC:21699 CERKL
HPAiHPA035443
HPA035444
HPA043203
MalaCardsiCERKL
MIMi608380 phenotype
608381 gene
neXtProtiNX_Q49MI3
OpenTargetsiENSG00000188452
Orphaneti791 Retinitis pigmentosa
PharmGKBiPA134984780

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1115 Eukaryota
KOG1116 Eukaryota
COG1597 LUCA
GeneTreeiENSGT00940000157578
HOGENOMiHOG000231784
InParanoidiQ49MI3
KOiK19602
OMAiSVMKECK
OrthoDBi681139at2759
PhylomeDBiQ49MI3
TreeFamiTF314514

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CERKL human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
375298
PharosiQ49MI3 Tbio

Protein Ontology

More...
PROi
PR:Q49MI3
RNActiQ49MI3 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000188452 Expressed in 89 organ(s), highest expression level in leukocyte

Family and domain databases

Gene3Di3.40.50.10330, 1 hit
InterProiView protein in InterPro
IPR017438 ATP-NAD_kinase_N
IPR001206 Diacylglycerol_kinase_cat_dom
IPR016064 NAD/diacylglycerol_kinase_sf
PfamiView protein in Pfam
PF00781 DAGK_cat, 1 hit
SUPFAMiSSF111331 SSF111331, 1 hit
PROSITEiView protein in PROSITE
PS50146 DAGK, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCERKL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q49MI3
Secondary accession number(s): B2RPL2
, B4DEY1, Q49MH9, Q49MI0, Q49MI1, Q49MI2, Q5DVJ2, Q5DVJ4, Q5DVJ5, Q6UZF6, Q6ZP59
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: September 13, 2005
Last modified: December 11, 2019
This is version 123 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again