Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (08 May 2019)
Sequence version 1 (13 Sep 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sodium-coupled monocarboxylate transporter 2

Gene

Slc5a12

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as an electroneutral and low-affinity sodium (Na+)-dependent sodium-coupled solute transporter. Catalyzes the transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, nicotinate, propionate, butyrate and beta-D-hydroxybutyrate. May be responsible for the first step of reabsorption of monocarboxylates from the lumen of the proximal tubule of the kidney and the small intestine. May play also a role in monocarboxylates transport in the retina. Mediates electroneutral uptake of lactate, with a stoichiometry of 2 Na+ for each lactate.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-427601 Multifunctional anion exchangers

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium-coupled monocarboxylate transporter 2
Alternative name(s):
Electroneutral sodium monocarboxylate cotransporter
Low-affinity sodium-lactate cotransporter
Solute carrier family 5 member 12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc5a12
Synonyms:Smct2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2138890 Slc5a12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 9ExtracellularSequence analysis9
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Topological domaini31 – 47CytoplasmicSequence analysisAdd BLAST17
Transmembranei48 – 68HelicalSequence analysisAdd BLAST21
Topological domaini69 – 80ExtracellularSequence analysisAdd BLAST12
Transmembranei81 – 101HelicalSequence analysisAdd BLAST21
Topological domaini102 – 128CytoplasmicSequence analysisAdd BLAST27
Transmembranei129 – 149HelicalSequence analysisAdd BLAST21
Topological domaini150 – 157ExtracellularSequence analysis8
Transmembranei158 – 178HelicalSequence analysisAdd BLAST21
Topological domaini179 – 180CytoplasmicSequence analysis2
Transmembranei181 – 201HelicalSequence analysisAdd BLAST21
Topological domaini202 – 235ExtracellularSequence analysisAdd BLAST34
Transmembranei236 – 256HelicalSequence analysisAdd BLAST21
Topological domaini257 – 275CytoplasmicSequence analysisAdd BLAST19
Transmembranei276 – 296HelicalSequence analysisAdd BLAST21
Topological domaini297 – 321ExtracellularSequence analysisAdd BLAST25
Transmembranei322 – 342HelicalSequence analysisAdd BLAST21
Topological domaini343 – 385CytoplasmicSequence analysisAdd BLAST43
Transmembranei386 – 406HelicalSequence analysisAdd BLAST21
Topological domaini407 – 411ExtracellularSequence analysis5
Transmembranei412 – 432HelicalSequence analysisAdd BLAST21
Topological domaini433 – 437CytoplasmicSequence analysis5
Transmembranei438 – 458HelicalSequence analysisAdd BLAST21
Topological domaini459 – 504ExtracellularSequence analysisAdd BLAST46
Transmembranei505 – 525HelicalSequence analysisAdd BLAST21
Topological domaini526 – 619CytoplasmicSequence analysisAdd BLAST94

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003376811 – 619Sodium-coupled monocarboxylate transporter 2Add BLAST619

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi219N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi480N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q49B93

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q49B93

PRoteomics IDEntifications database

More...
PRIDEi
Q49B93

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q49B93

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q49B93

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the cortical region of the kidney corresponding to the proximal tubule. Expressed in Mueller cells of the inner retina (at protein level). Isoform 1 is expressed in the retina, kidney, small intestine and skeletal muscle. Isoform 2 is not detected in the kidney, small intestine and skeletal muscle. In the kidney, expressed predominantly in tubular epithelial cells of the cortical region and in the convoluted portions of the proximal tubule (pars convoluta). In the small intestine, its expression is highest in the proximal part and gradually decreased towards the distal end. Expressed in the neural retina. Not detected in the caecum and colon.4 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by CEBPD.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000041644 Expressed in 38 organ(s), highest expression level in adult mammalian kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q49B93 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q49B93 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000047340

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2349 Eukaryota
COG0591 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159545

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261662

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q49B93

KEGG Orthology (KO)

More...
KOi
K14388

Identification of Orthologs from Complete Genome Data

More...
OMAi
AIADTWY

Database of Orthologous Groups

More...
OrthoDBi
1180002at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q49B93

TreeFam database of animal gene trees

More...
TreeFami
TF316728

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1730.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038377 Na/Glc_symporter_sf
IPR001734 Na/solute_symporter

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00474 SSF, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00813 sss, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50283 NA_SOLUT_SYMP_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q49B93-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRVKNFEAWD YVVFAGLFVI SSGIGVFFAI KERKKTTSRE FLVGGRQMSF
60 70 80 90 100
GPVALSLTAS FMSAVTVLGT PAEVYRFGAS FFLFLISYVF VVFFTSELFL
110 120 130 140 150
PVFYRSGITS TYEYLQLRFN KPVRYAATII YIVQTILYTG VVVYAPALAL
160 170 180 190 200
NQVTGFNLWA SVFATGIVCT FYCSLGGLKA VVWTDAFQMV VMIVGFLTVL
210 220 230 240 250
IQGSNHVGGF NNVLEKAGNG SRLHIVDFDV DPLRRHTFWT ITIGGTFTWL
260 270 280 290 300
GVYGVNQSTI QRCISCKTEK HAKLALYFNL LGLWIIVACA VFSGLIMYSH
310 320 330 340 350
FKDCDPWTSG VISAPDQLMP YFVMEIFATM PGLPGLFVAC AFSGTLSTVA
360 370 380 390 400
ASINALATVT FEDFVKSCFP HLSDKLSTWI SKGLCILFGI MCTSMAVVAS
410 420 430 440 450
LMGSVVQAAL SIHGMCGGPM LGLFTLGLVF PFVNWKGALG GLLTGITLSF
460 470 480 490 500
WVAIGSFIYP APESKTLPLP LSTEHCVELN ITTTVAPQIS SRPVLADTWY
510 520 530 540 550
SLSYLYFSAV GCLGCIAAGI IISFLTGKQR GKDIDPLLIR PVCNLFCFWS
560 570 580 590 600
KKYKTLCWCG VQHDRETEQD YLDSGSAWKQ GVESGLQNGL KQDTLAQIPG
610
YNPKEKSYSN SVPEKTTYF
Length:619
Mass (Da):67,951
Last modified:September 13, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB1C36211590A511A
GO
Isoform 2 (identifier: Q49B93-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     409-436: ALSIHGMCGGPMLGLFTLGLVFPFVNWK → PGIVSQERAITGSFQRNLASVCYGVSIWKLIM

Note: No experimental confirmation available.
Show »
Length:623
Mass (Da):68,470
Checksum:iD4103BC260819E86
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_033996409 – 436ALSIH…FVNWK → PGIVSQERAITGSFQRNLAS VCYGVSIWKLIM in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY964639 mRNA Translation: AAY32930.1
AF529222 mRNA Translation: AAQ09530.1
AK144004 mRNA Translation: BAE25658.1
AK165419 mRNA Translation: BAE38174.1
AL732495 Genomic DNA No translation available.
BX005257 Genomic DNA No translation available.
BC121791 mRNA Translation: AAI21792.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16512.1 [Q49B93-2]
CCDS50656.1 [Q49B93-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001003915.1, NM_001003915.2 [Q49B93-2]
NP_001171095.1, NM_001177624.1 [Q49B93-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000045972; ENSMUSP00000047340; ENSMUSG00000041644 [Q49B93-2]
ENSMUST00000111026; ENSMUSP00000106655; ENSMUSG00000041644 [Q49B93-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
241612

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:241612

UCSC genome browser

More...
UCSCi
uc008lmw.2 mouse [Q49B93-2]
uc008lmx.2 mouse [Q49B93-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY964639 mRNA Translation: AAY32930.1
AF529222 mRNA Translation: AAQ09530.1
AK144004 mRNA Translation: BAE25658.1
AK165419 mRNA Translation: BAE38174.1
AL732495 Genomic DNA No translation available.
BX005257 Genomic DNA No translation available.
BC121791 mRNA Translation: AAI21792.1
CCDSiCCDS16512.1 [Q49B93-2]
CCDS50656.1 [Q49B93-1]
RefSeqiNP_001003915.1, NM_001003915.2 [Q49B93-2]
NP_001171095.1, NM_001177624.1 [Q49B93-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000047340

PTM databases

iPTMnetiQ49B93
PhosphoSitePlusiQ49B93

Proteomic databases

jPOSTiQ49B93
PaxDbiQ49B93
PRIDEiQ49B93

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
241612
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000045972; ENSMUSP00000047340; ENSMUSG00000041644 [Q49B93-2]
ENSMUST00000111026; ENSMUSP00000106655; ENSMUSG00000041644 [Q49B93-1]
GeneIDi241612
KEGGimmu:241612
UCSCiuc008lmw.2 mouse [Q49B93-2]
uc008lmx.2 mouse [Q49B93-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
159963
MGIiMGI:2138890 Slc5a12

Phylogenomic databases

eggNOGiKOG2349 Eukaryota
COG0591 LUCA
GeneTreeiENSGT00940000159545
HOGENOMiHOG000261662
InParanoidiQ49B93
KOiK14388
OMAiAIADTWY
OrthoDBi1180002at2759
PhylomeDBiQ49B93
TreeFamiTF316728

Enzyme and pathway databases

ReactomeiR-MMU-427601 Multifunctional anion exchangers

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Slc5a12 mouse

Protein Ontology

More...
PROi
PR:Q49B93

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000041644 Expressed in 38 organ(s), highest expression level in adult mammalian kidney
ExpressionAtlasiQ49B93 baseline and differential
GenevisibleiQ49B93 MM

Family and domain databases

Gene3Di1.20.1730.10, 1 hit
InterProiView protein in InterPro
IPR038377 Na/Glc_symporter_sf
IPR001734 Na/solute_symporter
PfamiView protein in Pfam
PF00474 SSF, 1 hit
TIGRFAMsiTIGR00813 sss, 1 hit
PROSITEiView protein in PROSITE
PS50283 NA_SOLUT_SYMP_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSC5AC_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q49B93
Secondary accession number(s): Q0D2G1, Q6A4K8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: September 13, 2005
Last modified: May 8, 2019
This is version 116 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again