Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 124 (07 Oct 2020)
Sequence version 3 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Coiled-coil domain-containing protein 14

Gene

CCDC14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negatively regulates centriole duplication. Negatively regulates CEP63 and CDK2 centrosomal localization.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q49A88

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000175455.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25766, CCDC14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617147, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q49A88

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
64770

Open Targets

More...
OpenTargetsi
ENSG00000175455

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134990564

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q49A88, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CCDC14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439419

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003330431 – 953Coiled-coil domain-containing protein 14Add BLAST953

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei124PhosphoserineCombined sources1
Modified residuei670PhosphoserineCombined sources1
Modified residuei754PhosphoserineCombined sources1
Modified residuei798PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q49A88

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q49A88

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q49A88

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q49A88

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q49A88

PeptideAtlas

More...
PeptideAtlasi
Q49A88

PRoteomics IDEntifications database

More...
PRIDEi
Q49A88

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62026 [Q49A88-1]
62027 [Q49A88-2]
62028 [Q49A88-3]
62029 [Q49A88-4]
62030 [Q49A88-5]
62031 [Q49A88-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q49A88

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q49A88

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000175455, Expressed in lung and 215 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q49A88, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q49A88, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000175455, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CEP63.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122281, 86 interactors

Database of interacting proteins

More...
DIPi
DIP-47727N

Protein interaction database and analysis system

More...
IntActi
Q49A88, 61 interactors

Molecular INTeraction database

More...
MINTi
Q49A88

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000420180

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q49A88, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q49A88

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili383 – 413Sequence analysisAdd BLAST31
Coiled coili483 – 618Sequence analysisAdd BLAST136

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502R84N, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017916

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_015403_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q49A88

KEGG Orthology (KO)

More...
KOi
K16541

Identification of Orthologs from Complete Genome Data

More...
OMAi
YSENRCN

Database of Orthologous Groups

More...
OrthoDBi
164484at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q49A88

TreeFam database of animal gene trees

More...
TreeFami
TF332390

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029343, CCDC14

The PANTHER Classification System

More...
PANTHERi
PTHR22367, PTHR22367, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15254, CCDC14, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q49A88-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKRGIRRDPF RKRKLGGRAK KVREPTAVNS FYREASLPSV WASLRRREMV
60 70 80 90 100
RSGARPGQVL SSGRHTGPAK LTNGKKATYL RKIPRFNADS GYSIHSDSES
110 120 130 140 150
QAETVHGLDG CASLLRDILR NEDSGSETAY LENRSNSRPL ESKRYGSKKK
160 170 180 190 200
RHEKHTIPLV VQKETSSSDN KKQIPNEASA RSERDTSDLE QNWSLQDHYR
210 220 230 240 250
MYSPIIYQAL CEHVQTQMSL MNDLTSKNIP NGIPAVPCHA PSHSESQATP
260 270 280 290 300
HSSYGLCTST PVWSLQRPPC PPKVHSEVQT DGNSQFASQG KTVSATCTDV
310 320 330 340 350
LRNSFNTSPG VPCSLPKTDI SAIPTLQQLG LVNGILPQQG IHKETDLLKC
360 370 380 390 400
IQTYLSLFRS HGKETHLDSQ THRSPTQSQP AFLATNEEKC AREQIREATS
410 420 430 440 450
ERKDLNIHVR DTKTVKDVQK AKNVNKTAEK VRIIKYLLGE LKALVAEQED
460 470 480 490 500
SEIQRLITEM EACISVLPTV SGNTDIQVEI ALAMQPLRSE NAQLRRQLRI
510 520 530 540 550
LNQQLREQQK TQKPSGAVDC NLELFSLQSL NMSLQNQLEE SLKSQELLQS
560 570 580 590 600
KNEELLKVIE NQKDENKKFS SIFKDKDQTI LENKQQYDIE ITRIKIELEE
610 620 630 640 650
ALVNVKSSQF KLETAEKENQ ILGITLRQRD AEVTRLRELT RTLQTSMAKL
660 670 680 690 700
LSDLSVDSAR CKPGNNLTKS LLNIHDKQLQ HDPAPAHTSI MSYLNKLETN
710 720 730 740 750
YSFTHSEPLS TIKNEETIEP DKTYENVLSS RGPQNSNTRG MEEASAPGII
760 770 780 790 800
SALSKQDSDE GSETMALIED EHNLDNTIYI PFARSTPEKK SPLSKRLSPQ
810 820 830 840 850
PQIRAATTQL VSNSGLAVSG KENKLCTPVI CSSSTKEAED APEKLSRASD
860 870 880 890 900
MKDTQLLKKI KEAIGKIPAA TKEPEEQTAC HGPSGCLSNS LQVKGNTVCD
910 920 930 940 950
GSVFTSDLMS DWSISSFSTF TSRDEQDFRN GLAALDANIA RLQKSLRTGL

LEK
Length:953
Mass (Da):106,302
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3B4335D2641E476A
GO
Isoform 2 (identifier: Q49A88-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-200: Missing.

Show »
Length:753
Mass (Da):83,599
Checksum:i8F64730141A16627
GO
Isoform 3 (identifier: Q49A88-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-160: Missing.
     161-166: VQKETS → MPMESA

Show »
Length:793
Mass (Da):88,234
Checksum:iFB67E9C79E3A72A1
GO
Isoform 4 (identifier: Q49A88-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-200: Missing.
     642-655: TLQTSMAKLLSDLS → KQKMHLKNFPEHLI
     656-953: Missing.

Show »
Length:455
Mass (Da):51,459
Checksum:iDA30C10CCA089186
GO
Isoform 5 (identifier: Q49A88-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-448: Missing.

Show »
Length:794
Mass (Da):88,660
Checksum:iD91FEFED17625785
GO
Isoform 6 (identifier: Q49A88-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-166: GSETAYLENRSNSRPLESKRYGSKKKRHEKHTIPLVVQKETS → A

Show »
Length:912
Mass (Da):101,520
Checksum:i0CB80C2F67416034
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QT39J3QT39_HUMAN
Coiled-coil domain containing 14, i...
CCDC14 hCG_2022532
905Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MR27A0A0A0MR27_HUMAN
Coiled-coil domain-containing prote...
CCDC14
864Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JU82C9JU82_HUMAN
Coiled-coil domain-containing prote...
CCDC14
312Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSI8C9JSI8_HUMAN
Coiled-coil domain-containing prote...
CCDC14
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6B5C9J6B5_HUMAN
Coiled-coil domain-containing prote...
CCDC14
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5T3H7C5T3_HUMAN
Coiled-coil domain-containing prote...
CCDC14
257Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWZ1C9JWZ1_HUMAN
Coiled-coil domain-containing prote...
CCDC14
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BM06H3BM06_HUMAN
Coiled-coil domain-containing prote...
CCDC14
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2U5H7C2U5_HUMAN
Coiled-coil domain-containing prote...
CCDC14
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14329 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB55229 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAH11939 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti154K → E in BAH11939 (PubMed:14702039).Curated1
Sequence conflicti403K → R in CAD97804 (PubMed:17974005).Curated1
Sequence conflicti580I → T in AAH42613 (PubMed:15489334).Curated1
Sequence conflicti585Q → H in BAH11968 (PubMed:14702039).Curated1
Sequence conflicti689S → P in BAH11968 (PubMed:14702039).Curated1
Sequence conflicti790K → E in AAH42613 (PubMed:15489334).Curated1
Sequence conflicti821K → E in BAB14329 (PubMed:14702039).Curated1
Sequence conflicti886C → G in AAH42613 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043116365T → P3 PublicationsCorresponds to variant dbSNP:rs17310144Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0334551 – 200Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST200
Alternative sequenceiVSP_0334561 – 160Missing in isoform 3. 1 PublicationAdd BLAST160
Alternative sequenceiVSP_039080125 – 166GSETA…QKETS → A in isoform 6. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_033457161 – 166VQKETS → MPMESA in isoform 3. 1 Publication6
Alternative sequenceiVSP_033458290 – 448Missing in isoform 5. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_033459642 – 655TLQTS…LSDLS → KQKMHLKNFPEHLI in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_033460656 – 953Missing in isoform 4. 1 PublicationAdd BLAST298

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX537652 mRNA Translation: CAD97804.1
AL122079 mRNA Translation: CAB59254.1
AL833312 mRNA Translation: CAD91162.1
AK022954 mRNA Translation: BAB14329.1 Different initiation.
AK027607 mRNA Translation: BAB55229.1 Different initiation.
AK294979 mRNA Translation: BAH11939.1 Different initiation.
AK295091 mRNA Translation: BAH11968.1
AC117381 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79430.1
CH471052 Genomic DNA Translation: EAW79434.1
BC020246 mRNA Translation: AAH20246.1
BC040285 mRNA Translation: AAH40285.1
BC042613 mRNA Translation: AAH42613.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS77806.1 [Q49A88-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001295246.1, NM_001308317.1 [Q49A88-2]
NP_073594.4, NM_022757.4
XP_005247767.1, XM_005247710.4
XP_005247768.1, XM_005247711.4 [Q49A88-5]
XP_005247770.1, XM_005247713.2 [Q49A88-2]
XP_005247771.1, XM_005247714.2
XP_016862545.1, XM_017007056.1
XP_016862547.1, XM_017007058.1
XP_016862548.1, XM_017007059.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000485727; ENSP00000418002; ENSG00000175455 [Q49A88-2]
ENST00000488653; ENSP00000420180; ENSG00000175455 [Q49A88-6]
ENST00000489746; ENSP00000418403; ENSG00000175455 [Q49A88-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64770

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64770

UCSC genome browser

More...
UCSCi
uc003egx.5, human [Q49A88-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX537652 mRNA Translation: CAD97804.1
AL122079 mRNA Translation: CAB59254.1
AL833312 mRNA Translation: CAD91162.1
AK022954 mRNA Translation: BAB14329.1 Different initiation.
AK027607 mRNA Translation: BAB55229.1 Different initiation.
AK294979 mRNA Translation: BAH11939.1 Different initiation.
AK295091 mRNA Translation: BAH11968.1
AC117381 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79430.1
CH471052 Genomic DNA Translation: EAW79434.1
BC020246 mRNA Translation: AAH20246.1
BC040285 mRNA Translation: AAH40285.1
BC042613 mRNA Translation: AAH42613.1
CCDSiCCDS77806.1 [Q49A88-2]
RefSeqiNP_001295246.1, NM_001308317.1 [Q49A88-2]
NP_073594.4, NM_022757.4
XP_005247767.1, XM_005247710.4
XP_005247768.1, XM_005247711.4 [Q49A88-5]
XP_005247770.1, XM_005247713.2 [Q49A88-2]
XP_005247771.1, XM_005247714.2
XP_016862545.1, XM_017007056.1
XP_016862547.1, XM_017007058.1
XP_016862548.1, XM_017007059.1

3D structure databases

SMRiQ49A88
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122281, 86 interactors
DIPiDIP-47727N
IntActiQ49A88, 61 interactors
MINTiQ49A88
STRINGi9606.ENSP00000420180

PTM databases

iPTMnetiQ49A88
PhosphoSitePlusiQ49A88

Polymorphism and mutation databases

BioMutaiCCDC14
DMDMi296439419

Proteomic databases

EPDiQ49A88
jPOSTiQ49A88
MassIVEiQ49A88
MaxQBiQ49A88
PaxDbiQ49A88
PeptideAtlasiQ49A88
PRIDEiQ49A88
ProteomicsDBi62026 [Q49A88-1]
62027 [Q49A88-2]
62028 [Q49A88-3]
62029 [Q49A88-4]
62030 [Q49A88-5]
62031 [Q49A88-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
32961, 48 antibodies

Genome annotation databases

EnsembliENST00000485727; ENSP00000418002; ENSG00000175455 [Q49A88-2]
ENST00000488653; ENSP00000420180; ENSG00000175455 [Q49A88-6]
ENST00000489746; ENSP00000418403; ENSG00000175455 [Q49A88-2]
GeneIDi64770
KEGGihsa:64770
UCSCiuc003egx.5, human [Q49A88-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64770
DisGeNETi64770
EuPathDBiHostDB:ENSG00000175455.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CCDC14
HGNCiHGNC:25766, CCDC14
HPAiENSG00000175455, Low tissue specificity
MIMi617147, gene
neXtProtiNX_Q49A88
OpenTargetsiENSG00000175455
PharmGKBiPA134990564

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502R84N, Eukaryota
GeneTreeiENSGT00390000017916
HOGENOMiCLU_015403_0_0_1
InParanoidiQ49A88
KOiK16541
OMAiYSENRCN
OrthoDBi164484at2759
PhylomeDBiQ49A88
TreeFamiTF332390

Enzyme and pathway databases

PathwayCommonsiQ49A88

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
64770, 3 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CCDC14, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64770
PharosiQ49A88, Tbio

Protein Ontology

More...
PROi
PR:Q49A88
RNActiQ49A88, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000175455, Expressed in lung and 215 other tissues
ExpressionAtlasiQ49A88, baseline and differential
GenevisibleiQ49A88, HS

Family and domain databases

InterProiView protein in InterPro
IPR029343, CCDC14
PANTHERiPTHR22367, PTHR22367, 1 hit
PfamiView protein in Pfam
PF15254, CCDC14, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCCD14_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q49A88
Secondary accession number(s): B7Z2Q3
, B7Z2T2, B8ZZ41, B8ZZ58, D3DN98, Q7Z3N3, Q86T30, Q8IWF8, Q8WUJ8, Q96K47, Q9H9A3, Q9UFH0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 18, 2010
Last modified: October 7, 2020
This is version 124 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again