Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (12 Aug 2020)
Sequence version 2 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Polypeptide N-acetylgalactosaminyltransferase-like 6

Gene

GALNTL6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei180SubstrateBy similarity1
Binding sitei209SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi232ManganeseBy similarity1
Binding sitei233SubstrateBy similarity1
Metal bindingi234ManganeseBy similarity1
Binding sitei337SubstrateBy similarity1
Metal bindingi365ManganeseBy similarity1
Binding sitei368SubstrateBy similarity1
Binding sitei373SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase
LigandLectin, Manganese, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q49A17

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-913709, O-linked glycosylation of mucins

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00378

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
CBM13, Carbohydrate-Binding Module Family 13
GT27, Glycosyltransferase Family 27

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Polypeptide N-acetylgalactosaminyltransferase-like 6 (EC:2.4.1.41)
Alternative name(s):
Polypeptide GalNAc transferase 17
Short name:
GalNAc-T17
Short name:
pp-GaNTase 17
Protein-UDP acetylgalactosaminyltransferase 17
Putative polypeptide N-acetylgalactosaminyltransferase 17
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GALNTL6
Synonyms:GALNT17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000174473.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:33844, GALNTL6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615138, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q49A17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 7CytoplasmicSequence analysis7
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei8 – 28Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini29 – 601LumenalSequence analysisAdd BLAST573

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
442117

Open Targets

More...
OpenTargetsi
ENSG00000174473

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164720162

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q49A17, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GALNTL6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296434516

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003257741 – 601Polypeptide N-acetylgalactosaminyltransferase-like 6Add BLAST601

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi130 ↔ 360PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi141N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi351 ↔ 427PROSITE-ProRule annotation
Disulfide bondi466 ↔ 483PROSITE-ProRule annotation
Disulfide bondi518 ↔ 533PROSITE-ProRule annotation
Disulfide bondi558 ↔ 573PROSITE-ProRule annotation
Glycosylationi588N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q49A17

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q49A17

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q49A17

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q49A17

PeptideAtlas

More...
PeptideAtlasi
Q49A17

PRoteomics IDEntifications database

More...
PRIDEi
Q49A17

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
62014 [Q49A17-1]
62015 [Q49A17-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q49A17, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q49A17

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q49A17

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000174473, Expressed in caudate nucleus and 98 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q49A17, baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000174473, Tissue enhanced (brain, lymphoid tissue, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
138023, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000423313

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q49A17, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q49A17

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini453 – 585Ricin B-type lectinPROSITE-ProRule annotationAdd BLAST133

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni139 – 248Catalytic subdomain AAdd BLAST110
Regioni306 – 368Catalytic subdomain BAdd BLAST63

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3736, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155038

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q49A17

KEGG Orthology (KO)

More...
KOi
K00710

Identification of Orthologs from Complete Genome Data

More...
OMAi
FGFVNHT

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q49A17

TreeFam database of animal gene trees

More...
TreeFami
TF313267

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00161, RICIN, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.550.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001173, Glyco_trans_2-like
IPR029044, Nucleotide-diphossugar_trans
IPR035992, Ricin_B-like_lectins
IPR000772, Ricin_B_lectin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00535, Glycos_transf_2, 1 hit
PF00652, Ricin_B_lectin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00458, RICIN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50370, SSF50370, 1 hit
SSF53448, SSF53448, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50231, RICIN_B_LECTIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q49A17-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKRKQKRFLQ MTLLFTVALI FLPNVGLWSL YKDKHLVKSA EPGEQQTFPL
60 70 80 90 100
GLGDGQFYSW TDGLRRKDWH DYESIQKEAM RSGKGEHGKP YPLTEEDHDD
110 120 130 140 150
SAYRENGFNI FVSNNIALER SLPDIRHANC KHKMYLERLP NTSIIIPFHN
160 170 180 190 200
EGWTSLLRTI HSIINRTPGS LIAEIILVDD FSEREHLKDK LEEYMARFSK
210 220 230 240 250
VRIVRTKKRE GLIRTRLLGA SMARGEVLTF LDSHCEVNVN WLPPLLNQIA
260 270 280 290 300
LNHKTIVCPM IDVIDHNHFG YEAQAGDAMR GAFDWEMYYK RIPIPPELQR
310 320 330 340 350
ADPSDPFESP VMAGGLFAVD RKWFWELGGY DPGLEIWGGE QYEISFKVWM
360 370 380 390 400
CGGEMFDVPC SRVGHIYRKY VPYKVPSGTS LARNLKRVAE TWMDEFAEYI
410 420 430 440 450
YQRRPEYRHL STGDISAQKE LRKQLKCKDF KWFMAAVAWD VPKYYPPVEP
460 470 480 490 500
PPAAWGEIRN VAANLCVDSK HGATGTELRL DICVKDGSER TWSHEQLFTF
510 520 530 540 550
GWREDIRPGE PLHTRKFCFD AISHNSPVTL YDCHGMKGNQ LWGYRKDRTL
560 570 580 590 600
FHPVSNSCMD CNPAEKKIFM ARCDPLSETQ QWIFEHINMT VLEKFNHHAN

S
Length:601
Mass (Da):69,788
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDEFBE2E41DD2FC1D
GO
Isoform 2 (identifier: Q49A17-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MKRKQKRFLQMTLLFTVALIFLPNVGLWSLYKDKHLVKSAEPGEQ → MRAKFRAGAGHQRNPSISADHGVHELVY

Show »
Length:584
Mass (Da):67,589
Checksum:i5A97ED40D9AB1E8F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X115A0A087X115_HUMAN
Polypeptide N-acetylgalactosaminylt...
GALNTL6
417Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCP4D6RCP4_HUMAN
Polypeptide N-acetylgalactosaminylt...
GALNTL6
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti83G → R in AAH47551 (PubMed:15489334).Curated1
Sequence conflicti250A → P in AAH47551 (PubMed:15489334).Curated1
Sequence conflicti563P → H in AAH47551 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0324021 – 45MKRKQ…EPGEQ → MRAKFRAGAGHQRNPSISAD HGVHELVY in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ626725 mRNA Translation: CAF25036.1
AC024706 Genomic DNA No translation available.
AC025561 Genomic DNA No translation available.
AC025821 Genomic DNA No translation available.
AC093803 Genomic DNA No translation available.
AC095045 Genomic DNA No translation available.
AC095063 Genomic DNA No translation available.
AC097496 Genomic DNA No translation available.
AC105285 Genomic DNA No translation available.
AC108064 Genomic DNA No translation available.
AC109520 Genomic DNA No translation available.
AC110776 Genomic DNA No translation available.
AC131952 Genomic DNA No translation available.
BC047551 mRNA Translation: AAH47551.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34104.1 [Q49A17-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001030017.2, NM_001034845.2 [Q49A17-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000506823; ENSP00000423313; ENSG00000174473 [Q49A17-1]
ENST00000508122; ENSP00000423827; ENSG00000174473 [Q49A17-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
442117

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:442117

UCSC genome browser

More...
UCSCi
uc003isv.4, human [Q49A17-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ626725 mRNA Translation: CAF25036.1
AC024706 Genomic DNA No translation available.
AC025561 Genomic DNA No translation available.
AC025821 Genomic DNA No translation available.
AC093803 Genomic DNA No translation available.
AC095045 Genomic DNA No translation available.
AC095063 Genomic DNA No translation available.
AC097496 Genomic DNA No translation available.
AC105285 Genomic DNA No translation available.
AC108064 Genomic DNA No translation available.
AC109520 Genomic DNA No translation available.
AC110776 Genomic DNA No translation available.
AC131952 Genomic DNA No translation available.
BC047551 mRNA Translation: AAH47551.1
CCDSiCCDS34104.1 [Q49A17-1]
RefSeqiNP_001030017.2, NM_001034845.2 [Q49A17-1]

3D structure databases

SMRiQ49A17
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi138023, 1 interactor
STRINGi9606.ENSP00000423313

Protein family/group databases

CAZyiCBM13, Carbohydrate-Binding Module Family 13
GT27, Glycosyltransferase Family 27

PTM databases

GlyGeniQ49A17, 2 sites
iPTMnetiQ49A17
PhosphoSitePlusiQ49A17

Polymorphism and mutation databases

BioMutaiGALNTL6
DMDMi296434516

Proteomic databases

jPOSTiQ49A17
MassIVEiQ49A17
MaxQBiQ49A17
PaxDbiQ49A17
PeptideAtlasiQ49A17
PRIDEiQ49A17
ProteomicsDBi62014 [Q49A17-1]
62015 [Q49A17-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
28511, 30 antibodies

The DNASU plasmid repository

More...
DNASUi
442117

Genome annotation databases

EnsembliENST00000506823; ENSP00000423313; ENSG00000174473 [Q49A17-1]
ENST00000508122; ENSP00000423827; ENSG00000174473 [Q49A17-2]
GeneIDi442117
KEGGihsa:442117
UCSCiuc003isv.4, human [Q49A17-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
442117
DisGeNETi442117
EuPathDBiHostDB:ENSG00000174473.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GALNTL6
HGNCiHGNC:33844, GALNTL6
HPAiENSG00000174473, Tissue enhanced (brain, lymphoid tissue, testis)
MIMi615138, gene
neXtProtiNX_Q49A17
OpenTargetsiENSG00000174473
PharmGKBiPA164720162

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3736, Eukaryota
GeneTreeiENSGT00940000155038
InParanoidiQ49A17
KOiK00710
OMAiFGFVNHT
PhylomeDBiQ49A17
TreeFamiTF313267

Enzyme and pathway databases

UniPathwayiUPA00378
PathwayCommonsiQ49A17
ReactomeiR-HSA-913709, O-linked glycosylation of mucins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
442117, 3 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GALNTL6, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
442117
PharosiQ49A17, Tbio

Protein Ontology

More...
PROi
PR:Q49A17
RNActiQ49A17, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000174473, Expressed in caudate nucleus and 98 other tissues
ExpressionAtlasiQ49A17, baseline and differential

Family and domain databases

CDDicd00161, RICIN, 1 hit
Gene3Di3.90.550.10, 1 hit
InterProiView protein in InterPro
IPR001173, Glyco_trans_2-like
IPR029044, Nucleotide-diphossugar_trans
IPR035992, Ricin_B-like_lectins
IPR000772, Ricin_B_lectin
PfamiView protein in Pfam
PF00535, Glycos_transf_2, 1 hit
PF00652, Ricin_B_lectin, 1 hit
SMARTiView protein in SMART
SM00458, RICIN, 1 hit
SUPFAMiSSF50370, SSF50370, 1 hit
SSF53448, SSF53448, 1 hit
PROSITEiView protein in PROSITE
PS50231, RICIN_B_LECTIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGLTL6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q49A17
Secondary accession number(s): Q2L4S6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 18, 2010
Last modified: August 12, 2020
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again