Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C1orf109 homolog

Gene

C1orf109

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C1orf109 homologCurated
Gene namesi
Name:C1orf109By similarity
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:3041172 9930104L06Rik

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002743831 – 217Uncharacterized protein C1orf109 homologAdd BLAST217

Post-translational modificationi

Phosphorylated on serines by CK2 kinase.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ499E6

PTM databases

PhosphoSitePlusiQ499E6

Expressioni

Gene expression databases

CleanExiMM_9930104L06RIK

Interactioni

Protein-protein interaction databases

IntActiQ499E6, 1 interactor

Structurei

3D structure databases

SMRiQ499E6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

GeneTreeiENSGT00390000008551
HOVERGENiHBG080964
InParanoidiQ499E6
PhylomeDBiQ499E6

Family and domain databases

InterProiView protein in InterPro
IPR029159 CK2S
PfamiView protein in Pfam
PF15011 CK2S, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q499E6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAHDQPLLVV QEALRKCFPV VEEQQNLWQS TLQDCSPLLS SLSNLAEQLQ
60 70 80 90 100
AAQSLRFEDV PALRPFPDLQ ERLRRKQLEA GDVVLDKLAE RLATLLKVRN
110 120 130 140 150
TINSHVEQVF QAYEQHAAVL DIDTVLRPSV VSPSVADMLE WLQDIDRHYG
160 170 180 190 200
SSYLKRKYLL SSIHWGDLAS IQALPKAWDQ ISENECQTLV SDVLVSVSFF
210
LEEPGGCAAS GDLEHHS
Length:217
Mass (Da):24,442
Last modified:September 13, 2005 - v1
Checksum:i891D3EE1FC57426E
GO
Isoform 2 (identifier: Q499E6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     151-217: SSYLKRKYLLSSIHWGDLASIQALPKAWDQISENECQTLVSDVLVSVSFFLEEPGGCAASGDLEHHS → GSYPSSAS

Show »
Length:158
Mass (Da):17,831
Checksum:iE2A715FBD47406E4
GO
Isoform 3 (identifier: Q499E6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-217: Missing.

Show »
Length:92
Mass (Da):10,522
Checksum:i78188D9B7054B2FE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti62A → S in BC117984 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02273593 – 217Missing in isoform 3. 2 PublicationsAdd BLAST125
Alternative sequenceiVSP_022736151 – 217SSYLK…LEHHS → GSYPSSAS in isoform 2. 1 PublicationAdd BLAST67

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK037053 mRNA Translation: BAC29685.1
AK158126 mRNA Translation: BAE34372.1
AK160978 mRNA Translation: BAE36127.1
BC099946 mRNA Translation: AAH99946.1
BC117984 mRNA No translation available.
RefSeqiNP_808241.2, NM_177573.3 [Q499E6-1]
XP_006502949.1, XM_006502886.3
UniGeneiMm.266907

Genome annotation databases

EnsembliENSMUST00000094769; ENSMUSP00000154851; ENSMUSG00000044730 [Q499E6-1]
GeneIDi194268
KEGGimmu:194268
UCSCiuc008url.1 mouse [Q499E6-1]
uc008urm.1 mouse [Q499E6-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK037053 mRNA Translation: BAC29685.1
AK158126 mRNA Translation: BAE34372.1
AK160978 mRNA Translation: BAE36127.1
BC099946 mRNA Translation: AAH99946.1
BC117984 mRNA No translation available.
RefSeqiNP_808241.2, NM_177573.3 [Q499E6-1]
XP_006502949.1, XM_006502886.3
UniGeneiMm.266907

3D structure databases

SMRiQ499E6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ499E6, 1 interactor

PTM databases

PhosphoSitePlusiQ499E6

Proteomic databases

PRIDEiQ499E6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000094769; ENSMUSP00000154851; ENSMUSG00000044730 [Q499E6-1]
GeneIDi194268
KEGGimmu:194268
UCSCiuc008url.1 mouse [Q499E6-1]
uc008urm.1 mouse [Q499E6-3]

Organism-specific databases

MGIiMGI:3041172 9930104L06Rik

Phylogenomic databases

GeneTreeiENSGT00390000008551
HOVERGENiHBG080964
InParanoidiQ499E6
PhylomeDBiQ499E6

Miscellaneous databases

PROiPR:Q499E6
SOURCEiSearch...

Gene expression databases

CleanExiMM_9930104L06RIK

Family and domain databases

InterProiView protein in InterPro
IPR029159 CK2S
PfamiView protein in Pfam
PF15011 CK2S, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCA109_MOUSE
AccessioniPrimary (citable) accession number: Q499E6
Secondary accession number(s): Q148T1, Q3TU44, Q8BI05
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: September 13, 2005
Last modified: July 18, 2018
This is version 67 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again