Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 25 member 40

Gene

Slc25a40

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTransport

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 25 member 40
Gene namesi
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi1308774 Slc25a40

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei20 – 40Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei104 – 124Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei146 – 166Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei200 – 221Helical; Name=4Sequence analysisAdd BLAST22
Transmembranei240 – 260Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei299 – 319Helical; Name=6Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002918111 – 337Solute carrier family 25 member 40Add BLAST337

Proteomic databases

PaxDbiQ498U3
PRIDEiQ498U3

Expressioni

Tissue specificityi

Widely expressed at low level.1 Publication

Gene expression databases

BgeeiENSRNOG00000022837

Structurei

3D structure databases

ProteinModelPortaliQ498U3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati14 – 132Solcar 1Add BLAST119
Repeati140 – 224Solcar 2Add BLAST85
Repeati234 – 328Solcar 3Add BLAST95

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0761 Eukaryota
ENOG410XQVP LUCA
GeneTreeiENSGT00790000123051
HOGENOMiHOG000214473
HOVERGENiHBG011439
InParanoidiQ498U3
KOiK15119
OMAiKWLCEKS
OrthoDBiEOG091G07QQ
PhylomeDBiQ498U3

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR002067 Mit_carrier
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
PfamiView protein in Pfam
PF00153 Mito_carr, 3 hits
PRINTSiPR00926 MITOCARRIER
SUPFAMiSSF103506 SSF103506, 2 hits
PROSITEiView protein in PROSITE
PS50920 SOLCAR, 3 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q498U3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPETEGPPP TIQVTPLQQM MASCAGAVVT SLMVTPLDVV KIRLQAQNNP
60 70 80 90 100
FPKGKCFLYS NGLMDHICIC EEESKKAWYK KPGNFHGTLD AFLKIVRNEG
110 120 130 140 150
IKSLWSGLPP TLVMAVPATV IYFTCYEQLS TFLKTKLGEN ETRIPIVAGI
160 170 180 190 200
VARFGAVTMI SPLELIRTKM QSKTFSYKEL YQIVSMKVSE DGWISLWKGW
210 220 230 240 250
APTILRDVPF SAMYWYNYEN LRRWLCEKSD LYESTFMINF TAGALSGSFA
260 270 280 290 300
AVATLPFDVV KTQKQTQLWT HEYCKFPEPL DMSTWSIMKN IVADRGFSGL
310 320 330
FTGLIPRLVK IVPACAIMIS SYELGKGFFQ QQNVESR
Length:337
Mass (Da):38,061
Last modified:June 26, 2007 - v2
Checksum:i18DE77DB66F661ED
GO
Isoform 2 (identifier: Q498U3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-337: LIPRLVKIVPACAIMISSYELGKGFFQQQNVESR → ICLIKLSRLE...CTQCAQNIVK

Note: No experimental confirmation available.
Show »
Length:367
Mass (Da):41,021
Checksum:iC48783A55B82BE98
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026244304 – 337LIPRL…NVESR → ICLIKLSRLERCSAAKSIGC SSRGSRLISQHPPGNLDLSI TPVPGNLAPSPRHTCTQCAQ NIVK in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03033761 Genomic DNA No translation available.
BC100071 mRNA Translation: AAI00072.1
RefSeqiNP_001032263.1, NM_001037186.1 [Q498U3-2]
UniGeneiRn.204764

Genome annotation databases

EnsembliENSRNOT00000030352; ENSRNOP00000029371; ENSRNOG00000022837 [Q498U3-1]
ENSRNOT00000061342; ENSRNOP00000058058; ENSRNOG00000022837 [Q498U3-2]
GeneIDi296813
KEGGirno:296813

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiS2540_RAT
AccessioniPrimary (citable) accession number: Q498U3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: May 23, 2018
This is version 87 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health