UniProtKB - Q498B9 (Q498B9_HUMAN)

BLAST

>tr|Q498B9|Q498B9_HUMAN ASXL1 protein OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=1
MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAML
HSNSRGGEGLFYKLPGRISLFTLKV

Align
Format
Add to basket Added to basket
History
Entry version 91 (07 Nov 2018)
Sequence version 1 (13 Sep 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Submitted name:

ASXL1 protein

Gene

ASXL1

Organism

Homo sapiens (Human)

Status

Unreviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

GO - Biological processⁱ

regulation of transcription, DNA-templated Source: InterPro
transcription, DNA-templated Source: InterPro

View the complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Submitted name: ASXL1 proteinImported Submitted name: Putative Polycomb group protein ASXL1Imported
Gene namesⁱ	Name:ASXL1Imported
Organismⁱ	Homo sapiens (Human)Imported
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 20

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000171456.16
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:18318 ASXL1

Pathology & Biotechⁱ

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000171456
PharmGKBⁱ	PA25078

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000171456 Expressed in 227 organ(s), highest expression level in left lobe of thyroid gland

Bgeeⁱ

ENSG00000171456 Expressed in 227 organ(s), highest expression level in left lobe of thyroid gland

Interactionⁱ

Protein-protein interaction databases

IntActⁱ	Q498B9, 1 interactor Q498B9, 1 interactor

IntActⁱ

Q498B9, 1 interactor
Q498B9, 1 interactor

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	11 – 82	HARE-HTHInterPro annotationAdd BLAST		72

Phylogenomic databases

eggNOGⁱ	ENOG410IGAP Eukaryota ENOG410YF2J LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00520000055578
HOVERGENⁱ	HBG062365

Family and domain databases

InterProⁱ	View protein in InterPro IPR024811 ASX/ASX-like IPR024815 ASXL1 IPR007759 HB1/Asxl_HTH
PANTHERⁱ	PTHR13578 PTHR13578, 1 hit PTHR13578:SF19 PTHR13578:SF19, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF05066 HARE-HTH, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 11 potential isoforms that are computationally mapped.Show all Align All

Q498B9-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MKDKQKKKKE RTWAEAARLV LENYSDAPMT PKQILQVIEA EGLKEMRSGT 
        60         70         80 
SPLACLNAML HSNSRGGEGL FYKLPGRISL FTLKV

Length:85

Mass (Da):9,550

Last modified:September 13, 2005 - v1

Checksum:ⁱ8AF0F72066DC1F4B

Computationally mapped potential isoform sequencesⁱ

There are 11 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name	Protein names	Gene names	Length	Annotation

	Q8IXJ9	ASXL1_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1 (Additional sex combs-like protein 1)	ASXL1 KIAA0978	1,541	Annotation score:
	Q76L82	Q76L82_HUMAN	Additional sex combs like 1 (Drosop... Additional sex combs like 1 (Drosophila), isoform CRA_d (Putative Polycomb group protein ASXL1)	ASXL1 ASXH1, hCG_38816	1,536	Annotation score:
	A0A2R8Y5U1	A0A2R8Y5U1_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1	ASXL1	1,480	Annotation score:
	Q5JWS8	Q5JWS8_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1	ASXL1	81	Annotation score:
	H0YJC9	H0YJC9_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1	ASXL1	75	Annotation score:
	A0A087WWN0	A0A087WWN0_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1	ASXL1	57	Annotation score:
	Q6P1M8	Q6P1M8_HUMAN	ASXL1 protein ASXL1 protein (Putative Polycomb group protein ASXL1)	ASXL1	84	Annotation score:
	A0A2R8Y627	A0A2R8Y627_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1	ASXL1	135	Annotation score:
	A0A2R8Y6V0	A0A2R8Y6V0_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1	ASXL1	78	Annotation score:
	A0A2R8Y4U9	A0A2R8Y4U9_HUMAN	Putative Polycomb group protein ASX... Putative Polycomb group protein ASXL1	ASXL1	85	Annotation score:
There is more potential isoformShow all

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AL034550 Genomic DNA No translation available. AL121583 Genomic DNA No translation available. KF495689 Genomic DNA No translation available. BC100280 mRNA Translation: AAI00281.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001158075.1, NM_001164603.1
UniGeneⁱ	Hs.374043

Genome annotation databases

Ensemblⁱ	ENST00000542461; ENSP00000438654; ENSG00000171456 ENST00000646367; ENSP00000493987; ENSG00000171456
GeneIDⁱ	171023
UCSC genome browser More...UCSCⁱ	uc061weh.1 human

Protein	Similar proteins		Species	Score	Length	Source
Q498B9	ASXL1 isoform 11		PANTR		85	UniRef100_Q498B9
ASXL1 isoform 1		PONAB		85
ASXL1 isoform 6 (Fragment)		PONAB		73
ASXL1 isoform 12 (Fragment)		PANTR		73

Protein	Similar proteins		Species	Score	Length	Source
Q498B9	ASXL1 isoform 11		PANTR		85	UniRef90_Q498B9
ASXL1 isoform 1		PONAB		85
Uncharacterized protein		CHICK		103
putative Polycomb group protein ASXL1 isoform X2		TURTR		86
Uncharacterized protein		RHIBE		85
+10

Protein	Similar proteins		Species	Score	Length	Source
Q498B9	ASXL1 isoform 11		PANTR		85	UniRef50_Q498B9
ASXL1 isoform 1		PONAB		85
Uncharacterized protein		CHICK		103
putative Polycomb group protein ASXL1 isoform X2		TURTR		86
Uncharacterized protein		RHIBE		85
+11

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AL034550 Genomic DNA No translation available. AL121583 Genomic DNA No translation available. KF495689 Genomic DNA No translation available. BC100280 mRNA Translation: AAI00281.1
RefSeqⁱ	NP_001158075.1, NM_001164603.1
UniGeneⁱ	Hs.374043

3D structure databases

ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

IntActⁱ	Q498B9, 1 interactor Q498B9, 1 interactor

IntActⁱ

Q498B9, 1 interactor
Q498B9, 1 interactor

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000542461; ENSP00000438654; ENSG00000171456 ENST00000646367; ENSP00000493987; ENSG00000171456
GeneIDⁱ	171023
UCSCⁱ	uc061weh.1 human

Organism-specific databases

CTDⁱ	171023
EuPathDBⁱ	HostDB:ENSG00000171456.16
HGNCⁱ	HGNC:18318 ASXL1
OpenTargetsⁱ	ENSG00000171456
PharmGKBⁱ	PA25078
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IGAP Eukaryota ENOG410YF2J LUCA
GeneTreeⁱ	ENSGT00520000055578
HOVERGENⁱ	HBG062365

Miscellaneous databases

ChiTaRSⁱ	ASXL1 human
GenomeRNAiⁱ	171023

Gene expression databases

Bgeeⁱ	ENSG00000171456 Expressed in 227 organ(s), highest expression level in left lobe of thyroid gland

Bgeeⁱ

ENSG00000171456 Expressed in 227 organ(s), highest expression level in left lobe of thyroid gland

Family and domain databases

InterProⁱ	View protein in InterPro IPR024811 ASX/ASX-like IPR024815 ASXL1 IPR007759 HB1/Asxl_HTH
PANTHERⁱ	PTHR13578 PTHR13578, 1 hit PTHR13578:SF19 PTHR13578:SF19, 1 hit
Pfamⁱ	View protein in Pfam PF05066 HARE-HTH, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	Q498B9_HUMAN
Accessionⁱ	Q498B9Primary (citable) accession number: Q498B9
Entry historyⁱ	Integrated into UniProtKB/TrEMBL:	September 13, 2005
	Last sequence update:	September 13, 2005
	Last modified:	November 7, 2018
	This is version 91 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Unreviewed (UniProtKB/TrEMBL)
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Proteomics identificationCombined sources, Reference proteomeImported

UniProtKB - Q498B9 (Q498B9_HUMAN)

Your basket is currently empty. ⁱ

ASXL1 protein

ASXL1

Select a section on the left to see content.

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Organism-specific databases

Pathology & Biotechⁱ

Organism-specific databases

Expressionⁱ

Gene expression databases

Interactionⁱ

Protein-protein interaction databases

Family & Domainsⁱ

Domains and Repeats

Phylogenomic databases

Family and domain databases

Sequence (1+)ⁱ

Computationally mapped potential isoform sequencesⁱ

Sequence databases

Genome annotation databases

Similar proteinsⁱ

Cross-referencesⁱ

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ

UniProt is an ELIXIR core data resource

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q498B9 (Q498B9_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

ASXL1 protein

ASXL1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Pathology & Biotechⁱ

Expressionⁱ

Interactionⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ