Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 11

Gene

FUT11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable fucosyltransferase.By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.4.1.152 2681
2.4.1.65 2681
UniPathwayi
UPA00378

Protein family/group databases

CAZyiGT10 Glycosyltransferase Family 10

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 11 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase XI
Short name:
Fuc-TXI
Short name:
FucT-XI
Galactoside 3-L-fucosyltransferase 11
Short name:
Fucosyltransferase 11
Gene namesi
Name:FUT11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000196968.10
HGNCiHGNC:19233 FUT11
neXtProtiNX_Q495W5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 7CytoplasmicSequence analysis7
Transmembranei8 – 24Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini25 – 492LumenalSequence analysisAdd BLAST468

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi170384
OpenTargetsiENSG00000196968
PharmGKBiPA134914077

Polymorphism and mutation databases

BioMutaiFUT11
DMDMi121943313

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002990091 – 492Alpha-(1,3)-fucosyltransferase 11Add BLAST492

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi98 ↔ 103By similarity
Glycosylationi166N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi389 ↔ 392By similarity
Glycosylationi443N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ495W5
MaxQBiQ495W5
PaxDbiQ495W5
PeptideAtlasiQ495W5
PRIDEiQ495W5
ProteomicsDBi61975
61976 [Q495W5-2]

PTM databases

iPTMnetiQ495W5
PhosphoSitePlusiQ495W5

Expressioni

Gene expression databases

BgeeiENSG00000196968 Expressed in 203 organ(s), highest expression level in sperm
CleanExiHS_FUT11
GenevisibleiQ495W5 HS

Organism-specific databases

HPAiHPA014033

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi128001, 25 interactors
IntActiQ495W5, 3 interactors
STRINGi9606.ENSP00000361932

Structurei

3D structure databases

ProteinModelPortaliQ495W5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2619 Eukaryota
ENOG410ZIMX LUCA
GeneTreeiENSGT00680000099679
HOGENOMiHOG000006538
HOVERGENiHBG055521
InParanoidiQ495W5
KOiK11257
OMAiGLFPHFP
OrthoDBiEOG091G064Z
PhylomeDBiQ495W5
TreeFamiTF316348

Family and domain databases

Gene3Di3.40.50.11660, 1 hit
InterProiView protein in InterPro
IPR017176 Alpha-1_3-FUT_met
IPR031481 Glyco_tran_10_N
IPR001503 Glyco_trans_10
IPR038577 GT10-like_sf
PANTHERiPTHR11929 PTHR11929, 1 hit
PfamiView protein in Pfam
PF17039 Glyco_tran_10_N, 1 hit
PF00852 Glyco_transf_10, 1 hit
PIRSFiPIRSF037332 Alpha1_3FUT_met, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q495W5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAGPIRVVL VLLGVLSVCA ASGHGSVAER EAGGEAEWAE PWDGAVFRPP
60 70 80 90 100
SALGAVGVTR SSGTPRPGRE EAGDLPVLLW WSPGLFPHFP GDSERIECAR
110 120 130 140 150
GACVASRNRR ALRDSRTRAL LFYGTDFRAS AAPLPRLAHQ SWALLHEESP
160 170 180 190 200
LNNFLLSHGP GIRLFNLTST FSRHSDYPLS LQWLPGTAYL RRPVPPPMER
210 220 230 240 250
AEWRRRGYAP LLYLQSHCDV PADRDRYVRE LMRHIPVDSY GKCLQNRELP
260 270 280 290 300
TARLQDTATA TTEDPELLAF LSRYKFHLAL ENAICNDYMT EKLWRPMHLG
310 320 330 340 350
AVPVYRGSPS VRDWMPNNHS VILIDDFESP QKLAEFIDFL DKNDEEYMKY
360 370 380 390 400
LAYKQPGGIT NQFLLDSLKH REWGVNDPLL PNYLNGFECF VCDYELARLD
410 420 430 440 450
AEKAHAASPG DSPVFEPHIA QPSHMDCPVP TPGFGNVEEI PENDSWKEMW
460 470 480 490
LQDYWQGLDQ GEALTAMIHN NETEQTKFWD YLHEIFMKRQ HL
Length:492
Mass (Da):55,816
Last modified:September 13, 2005 - v1
Checksum:i19ED65D27DA6B30E
GO
Isoform 2 (identifier: Q495W5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     446-492: WKEMWLQDYW...HEIFMKRQHL → SLVQVRDHCICLRFLWPHSEKGRTHNYAAVP

Note: No experimental confirmation available.
Show »
Length:476
Mass (Da):53,510
Checksum:i01B3EBCA908931DA
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03476351S → A1 PublicationCorresponds to variant dbSNP:rs17853514Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027511446 – 492WKEMW…KRQHL → SLVQVRDHCICLRFLWPHSE KGRTHNYAAVP in isoform 2. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC036037 mRNA Translation: AAH36037.1
BC100994 mRNA Translation: AAI00995.1
BC100995 mRNA Translation: AAI00996.1
BC100996 mRNA Translation: AAI00997.1
BC100997 mRNA Translation: AAI00998.1
CCDSiCCDS60558.1 [Q495W5-2]
CCDS7333.1 [Q495W5-1]
RefSeqiNP_001271123.1, NM_001284194.1 [Q495W5-2]
NP_775811.2, NM_173540.2 [Q495W5-1]
UniGeneiHs.588854

Genome annotation databases

EnsembliENST00000372841; ENSP00000361932; ENSG00000196968 [Q495W5-1]
ENST00000394790; ENSP00000378270; ENSG00000196968 [Q495W5-2]
GeneIDi170384
KEGGihsa:170384
UCSCiuc001juz.3 human [Q495W5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - GTase

Fucosyltransferase 11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC036037 mRNA Translation: AAH36037.1
BC100994 mRNA Translation: AAI00995.1
BC100995 mRNA Translation: AAI00996.1
BC100996 mRNA Translation: AAI00997.1
BC100997 mRNA Translation: AAI00998.1
CCDSiCCDS60558.1 [Q495W5-2]
CCDS7333.1 [Q495W5-1]
RefSeqiNP_001271123.1, NM_001284194.1 [Q495W5-2]
NP_775811.2, NM_173540.2 [Q495W5-1]
UniGeneiHs.588854

3D structure databases

ProteinModelPortaliQ495W5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128001, 25 interactors
IntActiQ495W5, 3 interactors
STRINGi9606.ENSP00000361932

Protein family/group databases

CAZyiGT10 Glycosyltransferase Family 10

PTM databases

iPTMnetiQ495W5
PhosphoSitePlusiQ495W5

Polymorphism and mutation databases

BioMutaiFUT11
DMDMi121943313

Proteomic databases

EPDiQ495W5
MaxQBiQ495W5
PaxDbiQ495W5
PeptideAtlasiQ495W5
PRIDEiQ495W5
ProteomicsDBi61975
61976 [Q495W5-2]

Protocols and materials databases

DNASUi170384
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372841; ENSP00000361932; ENSG00000196968 [Q495W5-1]
ENST00000394790; ENSP00000378270; ENSG00000196968 [Q495W5-2]
GeneIDi170384
KEGGihsa:170384
UCSCiuc001juz.3 human [Q495W5-1]

Organism-specific databases

CTDi170384
DisGeNETi170384
EuPathDBiHostDB:ENSG00000196968.10
GeneCardsiFUT11
H-InvDBiHIX0035535
HGNCiHGNC:19233 FUT11
HPAiHPA014033
neXtProtiNX_Q495W5
OpenTargetsiENSG00000196968
PharmGKBiPA134914077
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2619 Eukaryota
ENOG410ZIMX LUCA
GeneTreeiENSGT00680000099679
HOGENOMiHOG000006538
HOVERGENiHBG055521
InParanoidiQ495W5
KOiK11257
OMAiGLFPHFP
OrthoDBiEOG091G064Z
PhylomeDBiQ495W5
TreeFamiTF316348

Enzyme and pathway databases

UniPathwayi
UPA00378

BRENDAi2.4.1.152 2681
2.4.1.65 2681

Miscellaneous databases

GenomeRNAii170384
PROiPR:Q495W5

Gene expression databases

BgeeiENSG00000196968 Expressed in 203 organ(s), highest expression level in sperm
CleanExiHS_FUT11
GenevisibleiQ495W5 HS

Family and domain databases

Gene3Di3.40.50.11660, 1 hit
InterProiView protein in InterPro
IPR017176 Alpha-1_3-FUT_met
IPR031481 Glyco_tran_10_N
IPR001503 Glyco_trans_10
IPR038577 GT10-like_sf
PANTHERiPTHR11929 PTHR11929, 1 hit
PfamiView protein in Pfam
PF17039 Glyco_tran_10_N, 1 hit
PF00852 Glyco_transf_10, 1 hit
PIRSFiPIRSF037332 Alpha1_3FUT_met, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFUT11_HUMAN
AccessioniPrimary (citable) accession number: Q495W5
Secondary accession number(s): Q495W7, Q8IYE4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: September 13, 2005
Last modified: September 12, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again