Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 11

Gene

FUT11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable fucosyltransferase.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • alpha-(1->3)-fucosyltransferase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.4.1.152 2681
2.4.1.65 2681

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00378

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
GT10 Glycosyltransferase Family 10

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 11 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase XI
Short name:
Fuc-TXI
Short name:
FucT-XI
Galactoside 3-L-fucosyltransferase 11
Short name:
Fucosyltransferase 11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FUT11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000196968.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19233 FUT11

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q495W5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 7CytoplasmicSequence analysis7
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei8 – 24Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST17
Topological domaini25 – 492LumenalSequence analysisAdd BLAST468

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
170384

Open Targets

More...
OpenTargetsi
ENSG00000196968

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134914077

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FUT11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121943313

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002990091 – 492Alpha-(1,3)-fucosyltransferase 11Add BLAST492

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi98 ↔ 103By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi166N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi389 ↔ 392By similarity
Glycosylationi443N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q495W5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q495W5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q495W5

PeptideAtlas

More...
PeptideAtlasi
Q495W5

PRoteomics IDEntifications database

More...
PRIDEi
Q495W5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
61975
61976 [Q495W5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q495W5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q495W5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196968 Expressed in 203 organ(s), highest expression level in sperm

CleanEx database of gene expression profiles

More...
CleanExi
HS_FUT11

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q495W5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA014033

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128001, 25 interactors

Protein interaction database and analysis system

More...
IntActi
Q495W5, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361932

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q495W5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2619 Eukaryota
ENOG410ZIMX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158983

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006538

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG055521

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q495W5

KEGG Orthology (KO)

More...
KOi
K11257

Identification of Orthologs from Complete Genome Data

More...
OMAi
LLWWSPG

Database of Orthologous Groups

More...
OrthoDBi
EOG091G064Z

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q495W5

TreeFam database of animal gene trees

More...
TreeFami
TF316348

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.11660, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017176 Alpha-1_3-FUT_met
IPR031481 Glyco_tran_10_N
IPR001503 Glyco_trans_10
IPR038577 GT10-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11929 PTHR11929, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17039 Glyco_tran_10_N, 1 hit
PF00852 Glyco_transf_10, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037332 Alpha1_3FUT_met, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q495W5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAGPIRVVL VLLGVLSVCA ASGHGSVAER EAGGEAEWAE PWDGAVFRPP
60 70 80 90 100
SALGAVGVTR SSGTPRPGRE EAGDLPVLLW WSPGLFPHFP GDSERIECAR
110 120 130 140 150
GACVASRNRR ALRDSRTRAL LFYGTDFRAS AAPLPRLAHQ SWALLHEESP
160 170 180 190 200
LNNFLLSHGP GIRLFNLTST FSRHSDYPLS LQWLPGTAYL RRPVPPPMER
210 220 230 240 250
AEWRRRGYAP LLYLQSHCDV PADRDRYVRE LMRHIPVDSY GKCLQNRELP
260 270 280 290 300
TARLQDTATA TTEDPELLAF LSRYKFHLAL ENAICNDYMT EKLWRPMHLG
310 320 330 340 350
AVPVYRGSPS VRDWMPNNHS VILIDDFESP QKLAEFIDFL DKNDEEYMKY
360 370 380 390 400
LAYKQPGGIT NQFLLDSLKH REWGVNDPLL PNYLNGFECF VCDYELARLD
410 420 430 440 450
AEKAHAASPG DSPVFEPHIA QPSHMDCPVP TPGFGNVEEI PENDSWKEMW
460 470 480 490
LQDYWQGLDQ GEALTAMIHN NETEQTKFWD YLHEIFMKRQ HL
Length:492
Mass (Da):55,816
Last modified:September 13, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i19ED65D27DA6B30E
GO
Isoform 2 (identifier: Q495W5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     446-492: WKEMWLQDYW...HEIFMKRQHL → SLVQVRDHCICLRFLWPHSEKGRTHNYAAVP

Note: No experimental confirmation available.
Show »
Length:476
Mass (Da):53,510
Checksum:i01B3EBCA908931DA
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03476351S → A1 PublicationCorresponds to variant dbSNP:rs17853514Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027511446 – 492WKEMW…KRQHL → SLVQVRDHCICLRFLWPHSE KGRTHNYAAVP in isoform 2. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BC036037 mRNA Translation: AAH36037.1
BC100994 mRNA Translation: AAI00995.1
BC100995 mRNA Translation: AAI00996.1
BC100996 mRNA Translation: AAI00997.1
BC100997 mRNA Translation: AAI00998.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS60558.1 [Q495W5-2]
CCDS7333.1 [Q495W5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001271123.1, NM_001284194.1 [Q495W5-2]
NP_775811.2, NM_173540.2 [Q495W5-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.588854

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372841; ENSP00000361932; ENSG00000196968 [Q495W5-1]
ENST00000394790; ENSP00000378270; ENSG00000196968 [Q495W5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
170384

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:170384

UCSC genome browser

More...
UCSCi
uc001juz.3 human [Q495W5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - GTase

Fucosyltransferase 11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC036037 mRNA Translation: AAH36037.1
BC100994 mRNA Translation: AAI00995.1
BC100995 mRNA Translation: AAI00996.1
BC100996 mRNA Translation: AAI00997.1
BC100997 mRNA Translation: AAI00998.1
CCDSiCCDS60558.1 [Q495W5-2]
CCDS7333.1 [Q495W5-1]
RefSeqiNP_001271123.1, NM_001284194.1 [Q495W5-2]
NP_775811.2, NM_173540.2 [Q495W5-1]
UniGeneiHs.588854

3D structure databases

ProteinModelPortaliQ495W5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128001, 25 interactors
IntActiQ495W5, 3 interactors
STRINGi9606.ENSP00000361932

Protein family/group databases

CAZyiGT10 Glycosyltransferase Family 10

PTM databases

iPTMnetiQ495W5
PhosphoSitePlusiQ495W5

Polymorphism and mutation databases

BioMutaiFUT11
DMDMi121943313

Proteomic databases

EPDiQ495W5
MaxQBiQ495W5
PaxDbiQ495W5
PeptideAtlasiQ495W5
PRIDEiQ495W5
ProteomicsDBi61975
61976 [Q495W5-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
170384
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372841; ENSP00000361932; ENSG00000196968 [Q495W5-1]
ENST00000394790; ENSP00000378270; ENSG00000196968 [Q495W5-2]
GeneIDi170384
KEGGihsa:170384
UCSCiuc001juz.3 human [Q495W5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
170384
DisGeNETi170384
EuPathDBiHostDB:ENSG00000196968.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FUT11

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0035535
HGNCiHGNC:19233 FUT11
HPAiHPA014033
neXtProtiNX_Q495W5
OpenTargetsiENSG00000196968
PharmGKBiPA134914077

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2619 Eukaryota
ENOG410ZIMX LUCA
GeneTreeiENSGT00940000158983
HOGENOMiHOG000006538
HOVERGENiHBG055521
InParanoidiQ495W5
KOiK11257
OMAiLLWWSPG
OrthoDBiEOG091G064Z
PhylomeDBiQ495W5
TreeFamiTF316348

Enzyme and pathway databases

UniPathwayi
UPA00378

BRENDAi2.4.1.152 2681
2.4.1.65 2681

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
170384

Protein Ontology

More...
PROi
PR:Q495W5

Gene expression databases

BgeeiENSG00000196968 Expressed in 203 organ(s), highest expression level in sperm
CleanExiHS_FUT11
GenevisibleiQ495W5 HS

Family and domain databases

Gene3Di3.40.50.11660, 1 hit
InterProiView protein in InterPro
IPR017176 Alpha-1_3-FUT_met
IPR031481 Glyco_tran_10_N
IPR001503 Glyco_trans_10
IPR038577 GT10-like_sf
PANTHERiPTHR11929 PTHR11929, 1 hit
PfamiView protein in Pfam
PF17039 Glyco_tran_10_N, 1 hit
PF00852 Glyco_transf_10, 1 hit
PIRSFiPIRSF037332 Alpha1_3FUT_met, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFUT11_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q495W5
Secondary accession number(s): Q495W7, Q8IYE4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: September 13, 2005
Last modified: December 5, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again