Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proton-coupled amino acid transporter 3

Gene

SLC36A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.18.8.4 the amino acid/auxin permease (aaap) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Proton-coupled amino acid transporter 3
Short name:
Proton/amino acid transporter 3
Alternative name(s):
Solute carrier family 36 member 3
Tramdorin-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC36A3
Synonyms:PAT3, TRAMD2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000186334.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19659 SLC36A3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608332 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q495N2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 46CytoplasmicSequence analysisAdd BLAST46
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei47 – 67HelicalSequence analysisAdd BLAST21
Topological domaini68 – 71ExtracellularSequence analysis4
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 137CytoplasmicSequence analysisAdd BLAST45
Transmembranei138 – 158HelicalSequence analysisAdd BLAST21
Topological domaini159 – 185ExtracellularSequence analysisAdd BLAST27
Transmembranei186 – 206HelicalSequence analysisAdd BLAST21
Topological domaini207 – 210CytoplasmicSequence analysis4
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Topological domaini232 – 252ExtracellularSequence analysisAdd BLAST21
Transmembranei253 – 273HelicalSequence analysisAdd BLAST21
Topological domaini274 – 284CytoplasmicSequence analysisAdd BLAST11
Transmembranei285 – 305HelicalSequence analysisAdd BLAST21
Topological domaini306 – 337ExtracellularSequence analysisAdd BLAST32
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Topological domaini359 – 367CytoplasmicSequence analysis9
Transmembranei368 – 388HelicalSequence analysisAdd BLAST21
Topological domaini389 – 392ExtracellularSequence analysis4
Transmembranei393 – 413HelicalSequence analysisAdd BLAST21
Topological domaini414 – 425CytoplasmicSequence analysisAdd BLAST12
Transmembranei426 – 446HelicalSequence analysisAdd BLAST21
Topological domaini447 – 470ExtracellularSequence analysisAdd BLAST24

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134875494

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC36A3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172046109

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003262041 – 470Proton-coupled amino acid transporter 3Add BLAST470

Proteomic databases

PeptideAtlas

More...
PeptideAtlasi
Q495N2

PRoteomics IDEntifications database

More...
PRIDEi
Q495N2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
61967
61968 [Q495N2-2]
61969 [Q495N2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q495N2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q495N2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186334 Expressed in 10 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_SLC36A3

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
130167, 1 interactor

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q495N2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi21 – 28Poly-Ser8

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162406

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006823

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057183

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q495N2

KEGG Orthology (KO)

More...
KOi
K14209

Identification of Orthologs from Complete Genome Data

More...
OMAi
MYSLETC

Database of Orthologous Groups

More...
OrthoDBi
EOG091G079T

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q495N2

TreeFam database of animal gene trees

More...
TreeFami
TF314873

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013057 AA_transpt_TM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01490 Aa_trans, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q495N2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLLGRDYNS ELNSLDNGPQ SPSESSSSIT SENVHPAGEA GLSMMQTLIH
60 70 80 90 100
LLKCNIGTGL LGLPLAIKNA GLLVGPVSLL AIGVLTVHCM VILLNCAQHL
110 120 130 140 150
SQRLQKTFVN YGEATMYGLE TCPNTWLRAH AVWGRYTVSF LLVITQLGFC
160 170 180 190 200
SVYFMFMADN LQQMVEKAHV TSNICQPREI LTLTPILDIR FYMLIILPFL
210 220 230 240 250
ILLVFIQNLK VLSVFSTLAN ITTLGSMALI FEYIMEGIPY PSNLPLMANW
260 270 280 290 300
KTFLLFFGTA IFTFEGVGMV LPLKNQMKHP QQFSFVLYLG MSIVIILYIL
310 320 330 340 350
LGTLGYMKFG SDTQASITLN LPNCWLYQSV KLMYSIGIFF TYALQFHVPA
360 370 380 390 400
EIIIPFAISQ VSESWALFVD LSVRSALVCL TCVSAILIPR LDLVISLVGS
410 420 430 440 450
VSSSALALII PALLEIVIFY SEDMSCVTIA KDIMISIVGL LGCIFGTYQA
460 470
LYELPQPISH SMANSTGVHA
Length:470
Mass (Da):51,735
Last modified:March 18, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAA192584E6BFE848
GO
Isoform 2 (identifier: Q495N2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MSLLGRDYNS...PLAIKNAGLL → MGVIISGSLPPFSSPLQ
     135-135: R → RWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYR

Note: No experimental confirmation available.
Show »
Length:455
Mass (Da):50,247
Checksum:iD54930AF944FA361
GO
Isoform 3 (identifier: Q495N2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: R → RWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYR

Show »
Length:511
Mass (Da):56,095
Checksum:iDF198474F30498A5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti314Q → R in AAI01095 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_040006167K → E2 PublicationsCorresponds to variant dbSNP:rs978012Ensembl.1
Natural variantiVAR_040007185P → S. Corresponds to variant dbSNP:rs12520516Ensembl.1
Natural variantiVAR_040008190R → H. Corresponds to variant dbSNP:rs17660042Ensembl.1
Natural variantiVAR_040009415E → D. Corresponds to variant dbSNP:rs13155282Ensembl.1
Natural variantiVAR_040010421S → F. Corresponds to variant dbSNP:rs13155520Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0326011 – 73MSLLG…NAGLL → MGVIISGSLPPFSSPLQ in isoform 2. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_032602135R → RWNLALSPRLECSGKISAHC NPHLQGSSNSPAQASRVAGI YR in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY162215 mRNA Translation: AAO11789.1
AK127978 mRNA Translation: BAC87215.1
AK131483 mRNA Translation: BAD18628.1
CH471062 Genomic DNA Translation: EAW61679.1
BC101092 mRNA Translation: AAI01093.1
BC101093 mRNA Translation: AAI01094.1
BC101094 mRNA Translation: AAI01095.1
BC101095 mRNA Translation: AAI01096.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4314.1 [Q495N2-1]
CCDS47316.1 [Q495N2-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001138489.1, NM_001145017.1 [Q495N2-3]
NP_861439.3, NM_181774.3 [Q495N2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.720893

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000335230; ENSP00000334750; ENSG00000186334 [Q495N2-1]
ENST00000377713; ENSP00000366942; ENSG00000186334 [Q495N2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
285641

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:285641

UCSC genome browser

More...
UCSCi
uc003ltw.3 human [Q495N2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY162215 mRNA Translation: AAO11789.1
AK127978 mRNA Translation: BAC87215.1
AK131483 mRNA Translation: BAD18628.1
CH471062 Genomic DNA Translation: EAW61679.1
BC101092 mRNA Translation: AAI01093.1
BC101093 mRNA Translation: AAI01094.1
BC101094 mRNA Translation: AAI01095.1
BC101095 mRNA Translation: AAI01096.1
CCDSiCCDS4314.1 [Q495N2-1]
CCDS47316.1 [Q495N2-3]
RefSeqiNP_001138489.1, NM_001145017.1 [Q495N2-3]
NP_861439.3, NM_181774.3 [Q495N2-1]
UniGeneiHs.720893

3D structure databases

ProteinModelPortaliQ495N2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130167, 1 interactor

Protein family/group databases

TCDBi2.A.18.8.4 the amino acid/auxin permease (aaap) family

PTM databases

iPTMnetiQ495N2
PhosphoSitePlusiQ495N2

Polymorphism and mutation databases

BioMutaiSLC36A3
DMDMi172046109

Proteomic databases

PeptideAtlasiQ495N2
PRIDEiQ495N2
ProteomicsDBi61967
61968 [Q495N2-2]
61969 [Q495N2-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335230; ENSP00000334750; ENSG00000186334 [Q495N2-1]
ENST00000377713; ENSP00000366942; ENSG00000186334 [Q495N2-3]
GeneIDi285641
KEGGihsa:285641
UCSCiuc003ltw.3 human [Q495N2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
285641
EuPathDBiHostDB:ENSG00000186334.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC36A3
HGNCiHGNC:19659 SLC36A3
MIMi608332 gene
neXtProtiNX_Q495N2
PharmGKBiPA134875494

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000162406
HOGENOMiHOG000006823
HOVERGENiHBG057183
InParanoidiQ495N2
KOiK14209
OMAiMYSLETC
OrthoDBiEOG091G079T
PhylomeDBiQ495N2
TreeFamiTF314873

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
285641

Protein Ontology

More...
PROi
PR:Q495N2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186334 Expressed in 10 organ(s), highest expression level in testis
CleanExiHS_SLC36A3

Family and domain databases

InterProiView protein in InterPro
IPR013057 AA_transpt_TM
PfamiView protein in Pfam
PF01490 Aa_trans, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS36A3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q495N2
Secondary accession number(s): Q495N3
, Q6ZMU7, Q6ZRU4, Q7Z6B4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: December 5, 2018
This is version 95 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again