Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (08 May 2019)
Sequence version 3 (05 Apr 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein mono-ADP-ribosyltransferase PARP14

Gene

PARP14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins (PubMed:16061477, PubMed:27796300, PubMed:18851833, PubMed:25043379). In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation (PubMed:25043379). Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation (PubMed:27796300). However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703' (PubMed:29858569). Mono-ADP-ribosylates STAT6; enhancing STAT6-dependent transcription (PubMed:27796300). In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation (PubMed:27796300). Mono-ADP-ribosylates PARP9 (PubMed:27796300).1 Publication4 Publications

Caution

The role of PARP14-mediated ADP-ribosylation of STAT1 in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703'.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei824Substrate 1Combined sources1 Publication1
Binding sitei833Substrate 1; via amide nitrogenCombined sources1 Publication1
Binding sitei961Substrate 1Combined sources1 Publication1
Binding sitei1034Substrate 2Combined sources1 Publication1
Binding sitei1247Substrate 3Combined sources1 Publication1
Binding sitei1258Substrate 3; via amide nitrogenCombined sources1 Publication1
Binding sitei1371Substrate 3Combined sources1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase
Biological processImmunity, Innate immunity, Transcription, Transcription regulation
LigandNAD

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.4.2.30 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-197264 Nicotinamide salvaging

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein mono-ADP-ribosyltransferase PARP14Curated (EC:2.4.2.-4 Publications)
Alternative name(s):
ADP-ribosyltransferase diphtheria toxin-like 81 Publication
Short name:
ARTD81 Publication
B aggressive lymphoma protein 21 Publication
Poly [ADP-ribose] polymerase 141 Publication
Short name:
PARP-141 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PARP141 PublicationImported
Synonyms:BAL21 Publication, KIAA12681 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29232 PARP14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610028 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q460N5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1055G → E: Abolishes interaction with PARP10. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
54625

Open Targets

More...
OpenTargetsi
ENSG00000173193

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134861585

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2176777

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PARP14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
327478567

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002475891 – 1801Protein mono-ADP-ribosyltransferase PARP14Add BLAST1801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei33PhosphoserineCombined sources1
Modified residuei1403PhosphoserineCombined sources1
Modified residuei1411PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Auto-ADP-ribosylated.2 Publications

Keywords - PTMi

ADP-ribosylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q460N5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q460N5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q460N5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q460N5

PeptideAtlas

More...
PeptideAtlasi
Q460N5

PRoteomics IDEntifications database

More...
PRIDEi
Q460N5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
61930
61931 [Q460N5-1]
61932 [Q460N5-3]
61933 [Q460N5-4]
61934 [Q460N5-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q460N5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q460N5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in macrophages.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by IFNG in macrophages. Down-regulated by IL4 in macrophages.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173193 Expressed in 199 organ(s), highest expression level in layer of synovial tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q460N5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q460N5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008846
HPA012063

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with STAT6 (By similarity). Interacts with PARP10 (PubMed:23473667). Interacts with PARP9 in IFNG-stimulated macrophages; the interaction prevents PARP14-mediated STAT1 and STAT6 ADP-riboslylation (PubMed:27796300).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120082, 16 interactors

Database of interacting proteins

More...
DIPi
DIP-61130N

Protein interaction database and analysis system

More...
IntActi
Q460N5, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000418194

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q460N5

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3GOYX-ray2.80A/B/C/D1611-1801[»]
3Q6ZX-ray2.23A789-979[»]
3Q71X-ray2.20A999-1196[»]
3SE2X-ray2.30A/B/C/D1611-1801[»]
3SMIX-ray2.40A/B1611-1801[»]
3SMJX-ray1.50A/B1611-1801[»]
3VFQX-ray2.80A784-1196[»]
4ABKX-ray1.60A1208-1388[»]
4ABLX-ray1.15A1208-1388[»]
4D86X-ray2.00A784-1196[»]
4F1LX-ray1.90A/B/C/D1611-1801[»]
4F1QX-ray2.80A/B1611-1801[»]
4PY4X-ray2.76A/B1613-1801[»]
5LXPX-ray2.07A/B1611-1801[»]
5LYHX-ray2.17A/B1611-1801[»]
5NQEX-ray2.71A/B1611-1801[»]
5O2DX-ray1.60A994-1191[»]
5V7TX-ray2.30A1610-1801[»]
5V7WX-ray2.65A/B1610-1801[»]
6FYMX-ray2.15A/B/C/D1611-1801[»]
6FZMX-ray2.67A/B1611-1801[»]
6G0WX-ray2.34A/B1611-1801[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q460N5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q460N5

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini791 – 978Macro 1PROSITE-ProRule annotationAdd BLAST188
Domaini1003 – 1190Macro 2PROSITE-ProRule annotationAdd BLAST188
Domaini1216 – 1387Macro 3PROSITE-ProRule annotationAdd BLAST172
Domaini1523 – 1601WWEPROSITE-ProRule annotationAdd BLAST79
Domaini1605 – 1801PARP catalyticPROSITE-ProRule annotationAdd BLAST197

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni922 – 926Substrate 1 bindingCombined sources1 Publication5
Regioni1023 – 1024Substrate 2 bindingCombined sources1 Publication2
Regioni1046 – 1049Substrate 2 bindingCombined sources1 Publication4
Regioni1133 – 1137Substrate 2 bindingCombined sources1 Publication5
Regioni1175 – 1178Substrate 2 bindingCombined sources1 Publication4
Regioni1235 – 1236Substrate 3 bindingCombined sources1 Publication2
Regioni1332 – 1336Substrate 3 bindingCombined sources1 Publication5

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2633 Eukaryota
COG2110 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154311

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q460N5

KEGG Orthology (KO)

More...
KOi
K15261

Identification of Orthologs from Complete Genome Data

More...
OMAi
DVYKVKC

Database of Orthologous Groups

More...
OrthoDBi
681829at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q460N5

TreeFam database of animal gene trees

More...
TreeFami
TF328965

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12543 RRM2_PAR14, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 2 hits
3.30.720.50, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002589 Macro_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR034517 PAR14_RRM2
IPR012317 Poly(ADP-ribose)pol_cat_dom
IPR004170 WWE-dom
IPR037197 WWE_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01661 Macro, 3 hits
PF00644 PARP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00506 A1pp, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF117839 SSF117839, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51154 MACRO, 3 hits
PS51059 PARP_CATALYTIC, 1 hit
PS50918 WWE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 6 (identifier: Q460N5-6) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVPGSFPLL VEGSWGPDPP KNLNTKLQMY FQSPKRSGGG ECEVRQDPRS
60 70 80 90 100
PSRFLVFFYP EDVRQKVLER KNHELVWQGK GTFKLTVQLP ATPDEIDHVF
110 120 130 140 150
EEELLTKESK TKEDVKEPDV SEELDTKLPL DGGLDKMEDI PEECENISSL
160 170 180 190 200
VAFENLKANV TDIMLILLVE NISGLSNDDF QVEIIRDFDV AVVTFQKHID
210 220 230 240 250
TIRFVDDCTK HHSIKQLQLS PRLLEVTNTI RVENLPPGAD DYSLKLFFEN
260 270 280 290 300
PYNGGGRVAN VEYFPEESSA LIEFFDRKVL DTIMATKLDF NKMPLSVFPY
310 320 330 340 350
YASLGTALYG KEKPLIKLPA PFEESLDLPL WKFLQKKNHL IEEINDEMRR
360 370 380 390 400
CHCELTWSQL SGKVTIRPAA TLVNEGRPRI KTWQADTSTT LSSIRSKYKV
410 420 430 440 450
NPIKVDPTMW DTIKNDVKDD RILIEFDTLK EMVILAGKSE DVQSIEVQVR
460 470 480 490 500
ELIESTTQKI KREEQSLKEK MIISPGRYFL LCHSSLLDHL LTECPEIEIC
510 520 530 540 550
YDRVTQHLCL KGPSADVYKA KCEIQEKVYT MAQKNIQVSP EIFQFLQQVN
560 570 580 590 600
WKEFSKCLFI AQKILALYEL EGTTVLLTSC SSEALLEAEK QMLSALNYKR
610 620 630 640 650
IEVENKEVLH GKKWKGLTHN LLKKQNSSPN TVIINELTSE TTAEVIITGC
660 670 680 690 700
VKEVNETYKL LFNFVEQNMK IERLVEVKPS LVIDYLKTEK KLFWPKIKKV
710 720 730 740 750
NVQVSFNPEN KQKGILLTGS KTEVLKAVDI VKQVWDSVCV KSVHTDKPGA
760 770 780 790 800
KQFFQDKARF YQSEIKRLFG CYIELQENEV MKEGGSPAGQ KCFSRTVLAP
810 820 830 840 850
GVVLIVQQGD LARLPVDVVV NASNEDLKHY GGLAAALSKA AGPELQADCD
860 870 880 890 900
QIVKREGRLL PGNATISKAG KLPYHHVIHA VGPRWSGYEA PRCVYLLRRA
910 920 930 940 950
VQLSLCLAEK YKYRSIAIPA ISSGVFGFPL GRCVETIVSA IKENFQFKKD
960 970 980 990 1000
GHCLKEIYLV DVSEKTVEAF AEAVKTVFKA TLPDTAAPPG LPPAAAGPGK
1010 1020 1030 1040 1050
TSWEKGSLVS PGGLQMLLVK EGVQNAKTDV VVNSVPLDLV LSRGPLSKSL
1060 1070 1080 1090 1100
LEKAGPELQE ELDTVGQGVA VSMGTVLKTS SWNLDCRYVL HVVAPEWRNG
1110 1120 1130 1140 1150
STSSLKIMED IIRECMEITE SLSLKSIAFP AIGTGNLGFP KNIFAELIIS
1160 1170 1180 1190 1200
EVFKFSSKNQ LKTLQEVHFL LHPSDHENIQ AFSDEFARRA NGNLVSDKIP
1210 1220 1230 1240 1250
KAKDTQGFYG TVSSPDSGVY EMKIGSIIFQ VASGDITKEE ADVIVNSTSN
1260 1270 1280 1290 1300
SFNLKAGVSK AILECAGQNV ERECSQQAQQ RKNDYIITGG GFLRCKNIIH
1310 1320 1330 1340 1350
VIGGNDVKSS VSSVLQECEK KNYSSICLPA IGTGNAKQHP DKVAEAIIDA
1360 1370 1380 1390 1400
IEDFVQKGSA QSVKKVKVVI FLPQVLDVFY ANMKKREGTQ LSSQQSVMSK
1410 1420 1430 1440 1450
LASFLGFSKQ SPQKKNHLVL EKKTESATFR VCGENVTCVE YAISWLQDLI
1460 1470 1480 1490 1500
EKEQCPYTSE DECIKDFDEK EYQELNELQK KLNINISLDH KRPLIKVLGI
1510 1520 1530 1540 1550
SRDVMQARDE IEAMIKRVRL AKEQESRADC ISEFIEWQYN DNNTSHCFNK
1560 1570 1580 1590 1600
MTNLKLEDAR REKKKTVDVK INHRHYTVNL NTYTATDTKG HSLSVQRLTK
1610 1620 1630 1640 1650
SKVDIPAHWS DMKQQNFCVV ELLPSDPEYN TVASKFNQTC SHFRIEKIER
1660 1670 1680 1690 1700
IQNPDLWNSY QAKKKTMDAK NGQTMNEKQL FHGTDAGSVP HVNRNGFNRS
1710 1720 1730 1740 1750
YAGKNAVAYG KGTYFAVNAN YSANDTYSRP DANGRKHVYY VRVLTGIYTH
1760 1770 1780 1790 1800
GNHSLIVPPS KNPQNPTDLY DTVTDNVHHP SLFVAFYDYQ AYPEYLITFR

K
Length:1,801
Mass (Da):202,800
Last modified:April 5, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i27B027DFC7E773BD
GO
Isoform 1 (identifier: Q460N5-1) [UniParc]FASTAAdd to basket
Also known as: BAL2B

The sequence of this isoform differs from the canonical sequence as follows:
     119-199: Missing.

Show »
Length:1,720
Mass (Da):193,753
Checksum:iF7EAD232767F2867
GO
Isoform 3 (identifier: Q460N5-3) [UniParc]FASTAAdd to basket
Also known as: BAL2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-283: Missing.

Show »
Length:1,518
Mass (Da):170,601
Checksum:i8B8D7BFCB9682902
GO
Isoform 4 (identifier: Q460N5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1648-1680: IERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL → VSLLLECSFWMVEISSVMVLYKIHFHSLPITFF
     1681-1801: Missing.

Show »
Length:1,680
Mass (Da):189,177
Checksum:iBCDDC89D51466E28
GO
Isoform 5 (identifier: Q460N5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1004: Missing.
     1005-1013: KGSLVSPGG → MYLRRLLRP

Show »
Length:797
Mass (Da):89,790
Checksum:i978947F6DF05569E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C5R8H7C5R8_HUMAN
Protein mono-ADP-ribosyltransferase...
PARP14
1,521Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4Y3H7C4Y3_HUMAN
Protein mono-ADP-ribosyltransferase...
PARP14
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITD5A0A3B3ITD5_HUMAN
Protein mono-ADP-ribosyltransferase...
PARP14
292Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAY64449 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAY64450 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB14089 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence DB237115 differs from that shown. Reason: Frameshift at position 48.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti59Y → C in DB237115 (PubMed:16344560).Curated1
Sequence conflicti597N → D in BAG65132 (PubMed:14702039).Curated1
Sequence conflicti1239E → G in BAA91897 (PubMed:14702039).Curated1
Sequence conflicti1499G → A in AAN08627 (Ref. 1) Curated1
Sequence conflicti1521A → G in AAN08627 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0200131 – 1004Missing in isoform 5. 1 PublicationAdd BLAST1004
Alternative sequenceiVSP_0200141 – 283Missing in isoform 3. 1 PublicationAdd BLAST283
Alternative sequenceiVSP_040876119 – 199Missing in isoform 1. 3 PublicationsAdd BLAST81
Alternative sequenceiVSP_0200171005 – 1013KGSLVSPGG → MYLRRLLRP in isoform 5. 1 Publication9
Alternative sequenceiVSP_0200181648 – 1680IERIQ…NEKQL → VSLLLECSFWMVEISSVMVL YKIHFHSLPITFF in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_0200191681 – 1801Missing in isoform 4. 2 PublicationsAdd BLAST121

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY134858 mRNA Translation: AAN08627.1
AC048348 Genomic DNA No translation available.
AC092908 Genomic DNA No translation available.
AK001770 mRNA Translation: BAA91897.1
AK022542 mRNA Translation: BAB14089.1 Different initiation.
AK304269 mRNA Translation: BAG65132.1
DB237115 mRNA No translation available.
DQ063584 mRNA Translation: AAY64449.1 Different initiation.
DQ063585 mRNA Translation: AAY64450.1 Different initiation.
AB033094 mRNA Translation: BAA86582.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46894.1 [Q460N5-6]

NCBI Reference Sequences

More...
RefSeqi
NP_060024.2, NM_017554.2 [Q460N5-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000474629; ENSP00000418194; ENSG00000173193 [Q460N5-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54625

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54625

UCSC genome browser

More...
UCSCi
uc003efq.5 human [Q460N5-6]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY134858 mRNA Translation: AAN08627.1
AC048348 Genomic DNA No translation available.
AC092908 Genomic DNA No translation available.
AK001770 mRNA Translation: BAA91897.1
AK022542 mRNA Translation: BAB14089.1 Different initiation.
AK304269 mRNA Translation: BAG65132.1
DB237115 mRNA No translation available.
DQ063584 mRNA Translation: AAY64449.1 Different initiation.
DQ063585 mRNA Translation: AAY64450.1 Different initiation.
AB033094 mRNA Translation: BAA86582.1
CCDSiCCDS46894.1 [Q460N5-6]
RefSeqiNP_060024.2, NM_017554.2 [Q460N5-6]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3GOYX-ray2.80A/B/C/D1611-1801[»]
3Q6ZX-ray2.23A789-979[»]
3Q71X-ray2.20A999-1196[»]
3SE2X-ray2.30A/B/C/D1611-1801[»]
3SMIX-ray2.40A/B1611-1801[»]
3SMJX-ray1.50A/B1611-1801[»]
3VFQX-ray2.80A784-1196[»]
4ABKX-ray1.60A1208-1388[»]
4ABLX-ray1.15A1208-1388[»]
4D86X-ray2.00A784-1196[»]
4F1LX-ray1.90A/B/C/D1611-1801[»]
4F1QX-ray2.80A/B1611-1801[»]
4PY4X-ray2.76A/B1613-1801[»]
5LXPX-ray2.07A/B1611-1801[»]
5LYHX-ray2.17A/B1611-1801[»]
5NQEX-ray2.71A/B1611-1801[»]
5O2DX-ray1.60A994-1191[»]
5V7TX-ray2.30A1610-1801[»]
5V7WX-ray2.65A/B1610-1801[»]
6FYMX-ray2.15A/B/C/D1611-1801[»]
6FZMX-ray2.67A/B1611-1801[»]
6G0WX-ray2.34A/B1611-1801[»]
SMRiQ460N5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120082, 16 interactors
DIPiDIP-61130N
IntActiQ460N5, 2 interactors
STRINGi9606.ENSP00000418194

Chemistry databases

BindingDBiQ460N5
ChEMBLiCHEMBL2176777

PTM databases

iPTMnetiQ460N5
PhosphoSitePlusiQ460N5

Polymorphism and mutation databases

BioMutaiPARP14
DMDMi327478567

Proteomic databases

EPDiQ460N5
jPOSTiQ460N5
MaxQBiQ460N5
PaxDbiQ460N5
PeptideAtlasiQ460N5
PRIDEiQ460N5
ProteomicsDBi61930
61931 [Q460N5-1]
61932 [Q460N5-3]
61933 [Q460N5-4]
61934 [Q460N5-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000474629; ENSP00000418194; ENSG00000173193 [Q460N5-6]
GeneIDi54625
KEGGihsa:54625
UCSCiuc003efq.5 human [Q460N5-6]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54625
DisGeNETi54625

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PARP14

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0019605
HGNCiHGNC:29232 PARP14
HPAiHPA008846
HPA012063
MIMi610028 gene
neXtProtiNX_Q460N5
OpenTargetsiENSG00000173193
PharmGKBiPA134861585

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2633 Eukaryota
COG2110 LUCA
GeneTreeiENSGT00940000154311
InParanoidiQ460N5
KOiK15261
OMAiDVYKVKC
OrthoDBi681829at2759
PhylomeDBiQ460N5
TreeFamiTF328965

Enzyme and pathway databases

BRENDAi2.4.2.30 2681
ReactomeiR-HSA-197264 Nicotinamide salvaging

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PARP14 human
EvolutionaryTraceiQ460N5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54625

Protein Ontology

More...
PROi
PR:Q460N5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000173193 Expressed in 199 organ(s), highest expression level in layer of synovial tissue
ExpressionAtlasiQ460N5 baseline and differential
GenevisibleiQ460N5 HS

Family and domain databases

CDDicd12543 RRM2_PAR14, 1 hit
Gene3Di3.30.70.330, 2 hits
3.30.720.50, 1 hit
InterProiView protein in InterPro
IPR002589 Macro_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR034517 PAR14_RRM2
IPR012317 Poly(ADP-ribose)pol_cat_dom
IPR004170 WWE-dom
IPR037197 WWE_dom_sf
PfamiView protein in Pfam
PF01661 Macro, 3 hits
PF00644 PARP, 1 hit
SMARTiView protein in SMART
SM00506 A1pp, 3 hits
SUPFAMiSSF117839 SSF117839, 1 hit
PROSITEiView protein in PROSITE
PS51154 MACRO, 3 hits
PS51059 PARP_CATALYTIC, 1 hit
PS50918 WWE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPAR14_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q460N5
Secondary accession number(s): B4E2H0
, Q460N4, Q8J027, Q9H9X9, Q9NV60, Q9ULF2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: April 5, 2011
Last modified: May 8, 2019
This is version 130 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again