Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcriptional coactivator yorkie

Gene

yki

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional coactivator which is the critical downstream regulatory target in the Hippo/SWH (Sav/Wts/Hpo) signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki) oncoprotein. The Hippo/SWH signaling pathway inhibits the activity of the transcriptional complex formed by Scalloped (sd) and Yki and the target genes of this pathway include cyclin-E (cycE), diap1 and bantam. Regulates the expression of G1/S-specific cyclin-E (CycE) and apoptosis 1 inhibitor (th), thereby promoting cell proliferation and inhibiting apoptosis. Required for transcriptional activity of scalloped (sd) in wing imaginal disks. Induces expression of expression of vestigial (vg) in wing and haltere disks and the expression of transcription factor E2f (E2f).2 Publications

Miscellaneous

Named for its loss-of-function phenotype after a very small breed of dog, the Yorkshire Terrier.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 14-3-3 protein binding Source: FlyBase
  • kinase binding Source: UniProtKB
  • transcription coactivator activity Source: FlyBase
  • transcription factor binding Source: FlyBase

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-1251985 Nuclear signaling by ERBB4
R-DME-2028269 Signaling by Hippo
R-DME-2032785 YAP1- and WWTR1 (TAZ)-stimulated gene expression
R-DME-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-DME-390098 Phosphorylation-dependent inhibition of YKI
R-DME-390193 Transcriptional activation by YKI
R-DME-451806 Phosphorylation-independent inhibition of YKI
R-DME-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs
R-DME-8951671 RUNX3 regulates YAP1-mediated transcription

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q45VV3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcriptional coactivator yorkieCurated
Alternative name(s):
Protein yorkie1 Publication
Transcriptional coactivator YAP1 homologCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:yki
ORF Names:CG4005
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0034970 yki

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi88S → A: Increased activity and nuclear localization and decreased sensitivity to Hpo/Wts-mediated inhibition; when associated with A-227. 1 Publication1
Mutagenesisi145S → A: Increased activity and nuclear localization, decreased sensitivity to Hpo/Wts-mediated inhibition, loss of interaction with 14-3-3epsilon and 14-3-3zeta. 2 Publications1
Mutagenesisi227S → A: Increased activity and nuclear localization and decreased sensitivity to Hpo/Wts-mediated inhibition; when associated with A-88. 1 Publication1

Keywords - Diseasei

Proto-oncogene

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003932691 – 395Transcriptional coactivator yorkieAdd BLAST395

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei82Phosphoserine1 Publication1
Modified residuei88Phosphoserine1 Publication1
Modified residuei100Phosphoserine1 Publication1
Modified residuei117Phosphoserine1 Publication1
Modified residuei145Phosphoserine2 Publications1
Modified residuei149Phosphoserine1 Publication1
Modified residuei227Phosphoserine1 Publication1
Modified residuei228Phosphotyrosine1 Publication1
Modified residuei232Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Its activity is regulated by multiple phosphorylation events. Phosphorylation at Ser-88, Ser-145 and Ser-227 negatively regulate its activity and restrict its nuclear localization. Wts-mediated phosphorylation at Ser-145 promotes interaction with 14-3-3epsilon and 14-3-3zeta. Phosphorylation at Ser-88 and Ser-227 regulate nuclear localization and activity independent of 14-3-3 association.5 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q45VV3

PRoteomics IDEntifications database

More...
PRIDEi
Q45VV3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q45VV3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0034970 Expressed in 33 organ(s), highest expression level in adult Malpighian tubule (Drosophila)

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q45VV3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q45VV3 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via WW domains) with wts. Interacts (via N-terminus) with sd (via C-terminus) and this interaction enhances the transcriptional activity of sd. The phosphorylated form interacts with 14-3-3epsilon and 14-3-3zeta.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
MadP420032EBI-141254,EBI-162238

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
63430, 109 interactors

Protein interaction database and analysis system

More...
IntActi
Q45VV3, 7 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0288697

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q45VV3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q45VV3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini241 – 274WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini310 – 343WW 2PROSITE-ProRule annotationAdd BLAST34

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi278 – 281Poly-Gln4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the YAP1 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0940 Eukaryota
COG5021 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000046760

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q45VV3

KEGG Orthology (KO)

More...
KOi
K16687

Identification of Orthologs from Complete Genome Data

More...
OMAi
PFRMRKL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q45VV3

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00201 WW, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001202 WW_dom
IPR036020 WW_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00397 WW, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00456 WW, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51045 SSF51045, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01159 WW_DOMAIN_1, 2 hits
PS50020 WW_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform F (identifier: Q45VV3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLTTMSASSN TNSLIEKEID DEDMLSPIKS NNLVVRVNQD TDDNLQALFD
60 70 80 90 100
SVLNPGDAKR PLQLPLRMRK LPNSFFTPPA PSHSRANSAD STYDAGSQSS
110 120 130 140 150
INIGNKASIV QQPDGQSPIA AIPQLQIQPS PQHSRLAIHH SRARSSPASL
160 170 180 190 200
QQNYNVRARS DAAAANNPNA NPSSQQQPAG PTFPENSAQE FPSGAPASSA
210 220 230 240 250
IDLDAMNTCM SQDIPMSMQT VHKKQRSYDV ISPIQLNRQL GALPPGWEQA
260 270 280 290 300
KTNDGQIYYL NHTTKSTQWE DPRIQYRQQQ QILMAERIKQ NDVLQTTKQT
310 320 330 340 350
TTSTIANNLG PLPDGWEQAV TESGDLYFIN HIDRTTSWND PRMQSGLSVL
360 370 380 390
DCPDNLVSSL QIEDNLCSNL FNDAQAIVNP PSSHKPDDLE WYKIN
Length:395
Mass (Da):43,594
Last modified:June 11, 2014 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0F04A0C73D52C507
GO
Isoform D (identifier: Q45VV3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     292-344: DVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ → E

Show »
Length:343
Mass (Da):37,763
Checksum:iFEC625B8D3B20564
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0RNA4H0RNA4_DROME
FI16856p1
yki-RF CG4005, Dmel\CG4005, YAP, yap, YKI
418Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DHD4A0A0C4DHD4_DROME
Yorkie, isoform G
yki Dmel\CG4005, YAP, yap, YKI, Yki
395Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL13735 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAZ42161 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence ABM92835 differs from that shown. Reason: Frameshift at position 305.Curated
The sequence ABM92835 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence ABM92839 differs from that shown. Reason: Frameshift at position 305.Curated
The sequence ABM92839 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_038903292 – 344DVLQT…DPRMQ → E in isoform D. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ099897 mRNA Translation: AAZ42161.1 Different initiation.
AE013599 Genomic DNA Translation: ABI31113.2
AE013599 Genomic DNA Translation: AAF47156.4
AY058506 mRNA Translation: AAL13735.1 Different initiation.
BT029961 mRNA Translation: ABM92835.1 Sequence problems.
BT029965 mRNA Translation: ABM92839.1 Sequence problems.

NCBI Reference Sequences

More...
RefSeqi
NP_001036568.2, NM_001043103.2 [Q45VV3-1]
NP_611879.4, NM_138035.3 [Q45VV3-2]
NP_726414.3, NM_166657.5 [Q45VV3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Dm.4183

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0290256; FBpp0288695; FBgn0034970 [Q45VV3-2]
FBtr0290258; FBpp0288697; FBgn0034970 [Q45VV3-1]
FBtr0309372; FBpp0301274; FBgn0034970 [Q45VV3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
37851

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4005

UCSC genome browser

More...
UCSCi
CG4005-RD d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ099897 mRNA Translation: AAZ42161.1 Different initiation.
AE013599 Genomic DNA Translation: ABI31113.2
AE013599 Genomic DNA Translation: AAF47156.4
AY058506 mRNA Translation: AAL13735.1 Different initiation.
BT029961 mRNA Translation: ABM92835.1 Sequence problems.
BT029965 mRNA Translation: ABM92839.1 Sequence problems.
RefSeqiNP_001036568.2, NM_001043103.2 [Q45VV3-1]
NP_611879.4, NM_138035.3 [Q45VV3-2]
NP_726414.3, NM_166657.5 [Q45VV3-1]
UniGeneiDm.4183

3D structure databases

ProteinModelPortaliQ45VV3
SMRiQ45VV3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi63430, 109 interactors
IntActiQ45VV3, 7 interactors
STRINGi7227.FBpp0288697

PTM databases

iPTMnetiQ45VV3

Proteomic databases

PaxDbiQ45VV3
PRIDEiQ45VV3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0290256; FBpp0288695; FBgn0034970 [Q45VV3-2]
FBtr0290258; FBpp0288697; FBgn0034970 [Q45VV3-1]
FBtr0309372; FBpp0301274; FBgn0034970 [Q45VV3-1]
GeneIDi37851
KEGGidme:Dmel_CG4005
UCSCiCG4005-RD d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
37851
FlyBaseiFBgn0034970 yki

Phylogenomic databases

eggNOGiKOG0940 Eukaryota
COG5021 LUCA
GeneTreeiENSGT00510000046760
InParanoidiQ45VV3
KOiK16687
OMAiPFRMRKL
PhylomeDBiQ45VV3

Enzyme and pathway databases

ReactomeiR-DME-1251985 Nuclear signaling by ERBB4
R-DME-2028269 Signaling by Hippo
R-DME-2032785 YAP1- and WWTR1 (TAZ)-stimulated gene expression
R-DME-2173796 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
R-DME-390098 Phosphorylation-dependent inhibition of YKI
R-DME-390193 Transcriptional activation by YKI
R-DME-451806 Phosphorylation-independent inhibition of YKI
R-DME-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs
R-DME-8951671 RUNX3 regulates YAP1-mediated transcription
SignaLinkiQ45VV3

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
37851

Protein Ontology

More...
PROi
PR:Q45VV3

Gene expression databases

BgeeiFBgn0034970 Expressed in 33 organ(s), highest expression level in adult Malpighian tubule (Drosophila)
ExpressionAtlasiQ45VV3 baseline and differential
GenevisibleiQ45VV3 DM

Family and domain databases

CDDicd00201 WW, 2 hits
InterProiView protein in InterPro
IPR001202 WW_dom
IPR036020 WW_dom_sf
PfamiView protein in Pfam
PF00397 WW, 2 hits
SMARTiView protein in SMART
SM00456 WW, 2 hits
SUPFAMiSSF51045 SSF51045, 2 hits
PROSITEiView protein in PROSITE
PS01159 WW_DOMAIN_1, 2 hits
PS50020 WW_DOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiYAP1_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q45VV3
Secondary accession number(s): A2RVH0
, A2RVH4, Q0E8X1, Q7KVG6, Q95TU5, Q9W1B6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 23, 2010
Last sequence update: June 11, 2014
Last modified: January 16, 2019
This is version 116 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again