Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (31 Jul 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic

Gene

PAI2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: L-tryptophan biosynthesis

This protein is involved in step 3 of the subpathway that synthesizes L-tryptophan from chorismate.
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Anthranilate synthase beta subunit 2, chloroplastic (ASB2), Anthranilate synthase beta subunit 1, chloroplastic (ASB1), Anthranilate synthase alpha subunit 1, chloroplastic (ASA1), Anthranilate synthase alpha subunit 2, chloroplastic (ASA2)
  2. Anthranilate phosphoribosyltransferase, chloroplastic (PAT1)
  3. N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic (PAI1), N-(5'-phosphoribosyl)anthranilate isomerase 3, chloroplastic (PAI3), N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic (PAI2)
  4. Indole-3-glycerol phosphate synthase, chloroplastic (IGPS)
  5. Tryptophan synthase alpha chain (TRPA1), Tryptophan synthase alpha chain, chloroplastic (TSA1), Tryptophan synthase (AXX17_At5g53930), Tryptophan synthase (At5g54810), Tryptophan synthase (At5g28237), Tryptophan synthase (AXX17_At5g28490), Tryptophan synthase (AXX17_At4g31220), Tryptophan synthase, Tryptophan synthase beta chain 1, chloroplastic (TSB1), Tryptophan synthase (At4g27070), Tryptophan synthase (At5g28237), Tryptophan synthase (AXX17_At4g31220), Tryptophan synthase beta chain 2, chloroplastic (TSB2)
This subpathway is part of the pathway L-tryptophan biosynthesis, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-tryptophan from chorismate, the pathway L-tryptophan biosynthesis and in Amino-acid biosynthesis.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • phosphoribosylanthranilate isomerase activity Source: TAIR

GO - Biological processi

  • tryptophan biosynthetic process Source: TAIR

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase
Biological processAmino-acid biosynthesis, Aromatic amino acid biosynthesis, Tryptophan biosynthesis

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
ARA:AT5G05590-MONOMER

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00035;UER00042

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic (EC:5.3.1.24)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PAI2
Ordered Locus Names:At5g05590
ORF Names:MOP10.13
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT5G05590

The Arabidopsis Information Resource

More...
TAIRi
locus:2169687 AT5G05590

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Plastid

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 32ChloroplastSequence analysisAdd BLAST32
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000041745433 – 275N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplasticAdd BLAST243

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q42527

PRoteomics IDEntifications database

More...
PRIDEi
Q42527

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in roots and shoots.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By silver nitrate and UV irradiation.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q42527 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q42527 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
3702.AT5G05590.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q42527

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TrpF family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4202 Eukaryota
COG0135 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000161598

KEGG Orthology (KO)

More...
KOi
K01817

Identification of Orthologs from Complete Genome Data

More...
OMAi
CEIMEIC

Database of Orthologous Groups

More...
OrthoDBi
1536911at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q42527

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00405 PRAI, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.20.20.70, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00135 PRAI, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013785 Aldolase_TIM
IPR001240 PRAI
IPR011060 RibuloseP-bd_barrel

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00697 PRAI, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51366 SSF51366, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q42527-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTGISTDLH VHFGALNFSK TYKSGLSNRT VSFSRVGYAQ NRKLSCSVSN
60 70 80 90 100
TENVAPKDDE RGKDRPLVKM CGITSARDAA MAVEAGADFI GMIIWPHSKR
110 120 130 140 150
SISLSVAKDI SKVAREGGAK PVGVFVEDDD NTILRAADSS DLELVQLHGN
160 170 180 190 200
GSRAAFSRLV RKRRVIYVLN ANQDGKLLNE VPEEDCHLAD WILVDSATGG
210 220 230 240 250
SGHGFNWAQF KLPSVRSRNG WLLAGGINPT NVSEALSILQ PDGIDVSSGI
260 270
CGTDGIQKDK SKISSFITAV RSVHY
Length:275
Mass (Da):29,619
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFF55DC899925F2C7
GO
Isoform 2 (identifier: Q42527-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: Q → QVLYILIDFDFALTKVIFSTLLTVDSYGFLQ
     201-225: SGHGFNWAQFKLPSVRSRNGWLLAG → RYQEQLFNFFRIVMYSLEEKFKQSL
     226-275: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):28,314
Checksum:iFF8F1A55B2944244
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1P8B9M1A0A1P8B9M1_ARATH
Phosphoribosylanthranilate isomeras...
PAI2 MOP10.13, MOP10_13, At5g05590
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8B9P1A0A1P8B9P1_ARATH
Phosphoribosylanthranilate isomeras...
PAI2 MOP10.13, MOP10_13, At5g05590
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB11548 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BX829410 differs from that shown. Sequencing errors.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043742146Q → QVLYILIDFDFALTKVIFST LLTVDSYGFLQ in isoform 2. Curated1
Alternative sequenceiVSP_043743201 – 225SGHGF…WLLAG → RYQEQLFNFFRIVMYSLEEK FKQSL in isoform 2. CuratedAdd BLAST25
Alternative sequenceiVSP_043744226 – 275Missing in isoform 2. CuratedAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U18968 Genomic DNA Translation: AAC49003.1
AB005241 Genomic DNA Translation: BAB11548.1 Sequence problems.
CP002688 Genomic DNA Translation: AED90894.1
CP002688 Genomic DNA Translation: AED90895.1
BT003070 mRNA Translation: AAO23635.1
AK227265 mRNA Translation: BAE99293.1
BX829410 mRNA No translation available.

NCBI Reference Sequences

More...
RefSeqi
NP_196178.2, NM_120641.5 [Q42527-1]
NP_974734.1, NM_203005.2 [Q42527-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT5G05590.1; AT5G05590.1; AT5G05590 [Q42527-1]
AT5G05590.2; AT5G05590.2; AT5G05590 [Q42527-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
830442

Gramene; a comparative resource for plants

More...
Gramenei
AT5G05590.1; AT5G05590.1; AT5G05590 [Q42527-1]
AT5G05590.2; AT5G05590.2; AT5G05590 [Q42527-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT5G05590

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18968 Genomic DNA Translation: AAC49003.1
AB005241 Genomic DNA Translation: BAB11548.1 Sequence problems.
CP002688 Genomic DNA Translation: AED90894.1
CP002688 Genomic DNA Translation: AED90895.1
BT003070 mRNA Translation: AAO23635.1
AK227265 mRNA Translation: BAE99293.1
BX829410 mRNA No translation available.
RefSeqiNP_196178.2, NM_120641.5 [Q42527-1]
NP_974734.1, NM_203005.2 [Q42527-2]

3D structure databases

SMRiQ42527
ModBaseiSearch...

Protein-protein interaction databases

STRINGi3702.AT5G05590.1

Proteomic databases

PaxDbiQ42527
PRIDEiQ42527

Genome annotation databases

EnsemblPlantsiAT5G05590.1; AT5G05590.1; AT5G05590 [Q42527-1]
AT5G05590.2; AT5G05590.2; AT5G05590 [Q42527-2]
GeneIDi830442
GrameneiAT5G05590.1; AT5G05590.1; AT5G05590 [Q42527-1]
AT5G05590.2; AT5G05590.2; AT5G05590 [Q42527-2]
KEGGiath:AT5G05590

Organism-specific databases

AraportiAT5G05590
TAIRilocus:2169687 AT5G05590

Phylogenomic databases

eggNOGiKOG4202 Eukaryota
COG0135 LUCA
HOGENOMiHOG000161598
KOiK01817
OMAiCEIMEIC
OrthoDBi1536911at2759
PhylomeDBiQ42527

Enzyme and pathway databases

UniPathwayiUPA00035;UER00042
BioCyciARA:AT5G05590-MONOMER

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q42527

Gene expression databases

ExpressionAtlasiQ42527 baseline and differential
GenevisibleiQ42527 AT

Family and domain databases

CDDicd00405 PRAI, 1 hit
Gene3Di3.20.20.70, 1 hit
HAMAPiMF_00135 PRAI, 1 hit
InterProiView protein in InterPro
IPR013785 Aldolase_TIM
IPR001240 PRAI
IPR011060 RibuloseP-bd_barrel
PfamiView protein in Pfam
PF00697 PRAI, 1 hit
SUPFAMiSSF51366 SSF51366, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPAI2_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q42527
Secondary accession number(s): F4K0R4, Q9FFF7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2012
Last sequence update: November 1, 1996
Last modified: July 31, 2019
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again