Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable mitochondrial-processing peptidase subunit beta, mitochondrial

Gene

At3g02090

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cleaves presequences (transit peptides) from mitochondrial protein precursors.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Release of N-terminal transit peptides from precursor proteins imported into the mitochondrion, typically with Arg in position P2. EC:3.4.24.64

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi141ZincPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei144Proton acceptorPROSITE-ProRule annotation1
Metal bindingi145ZincPROSITE-ProRule annotation1
Active sitei214Curated1
Metal bindingi221ZincCurated1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • metalloendopeptidase activity Source: GO_Central
  • oxidoreductase activity Source: UniProtKB-KW
  • zinc ion binding Source: TAIR

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Oxidoreductase, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
ARA:AT3G02090-MONOMER
MetaCyc:AT3G02090-MONOMER

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M16.003

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable mitochondrial-processing peptidase subunit beta, mitochondrial (EC:3.4.24.64)
Alternative name(s):
Beta-MPP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Ordered Locus Names:At3g02090Imported
ORF Names:F1C9.12Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT3G02090

The Arabidopsis Information Resource

More...
TAIRi
locus:2078623 AT3G02090

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 78Mitochondrion1 PublicationAdd BLAST78
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004585279 – 531Probable mitochondrial-processing peptidase subunit beta, mitochondrialAdd BLAST453

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q42290

PRoteomics IDEntifications database

More...
PRIDEi
Q42290

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q42290 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q42290 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of alpha and beta subunits.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
6417, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q42290, 4 interactors

Molecular INTeraction database

More...
MINTi
Q42290

STRING: functional protein association networks

More...
STRINGi
3702.AT3G02090.2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q42290

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q42290

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi25 – 30Poly-Ser6
Compositional biasi46 – 49Poly-Pro4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M16 family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0960 Eukaryota
COG0612 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000242450

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q42290

KEGG Orthology (KO)

More...
KOi
K17732

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQEIREQ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q42290

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011249 Metalloenz_LuxS/M16
IPR011765 Pept_M16_N
IPR001431 Pept_M16_Zn_BS
IPR007863 Peptidase_M16_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00675 Peptidase_M16, 1 hit
PF05193 Peptidase_M16_C, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF63411 SSF63411, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00143 INSULINASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q42290-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMKNLLSLA RRSQRRLFLT QATRSSSSFS AIDSVPASAS PTALSPPPPH
60 70 80 90 100
LMPYDHAAEI IKNKIKKLEN PDKRFLKYAS PHPILASHNH ILSAPETRVT
110 120 130 140 150
TLPNGLRVAT ESNLSAKTAT VGVWIDAGSR FESDETNGTA HFLEHMIFKG
160 170 180 190 200
TDRRTVRALE EEIEDIGGHL NAYTSREQTT YYAKVLDSNV NQALDVLADI
210 220 230 240 250
LQNSKFEEQR INRERDVILR EMQEVEGQTD EVVLDHLHAT AFQYTPLGRT
260 270 280 290 300
ILGPAQNVKS ITREDLQNYI KTHYTASRMV IAAAGAVKHE EVVEQVKKLF
310 320 330 340 350
TKLSSDPTTT SQLVANEPAS FTGSEVRMID DDLPLAQFAV AFEGASWTDP
360 370 380 390 400
DSVALMVMQT MLGSWNKNVG GGKHVGSDLT QRVAINEIAE SIMAFNTNYK
410 420 430 440 450
DTGLFGVYAV AKADCLDDLS YAIMYEVTKL AYRVSDADVT RARNQLKSSL
460 470 480 490 500
LLHMDGTSPI AEDIGRQLLT YGRRIPTAEL FARIDAVDAS TVKRVANKYI
510 520 530
YDKDIAISAI GPIQDLPDYN KFRRRTYWNR Y
Length:531
Mass (Da):59,160
Last modified:January 24, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i08A3953AD192E6B5
GO
Isoform 2 (identifier: Q42290-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     504-531: DIAISAIGPIQDLPDYNKFRRRTYWNRY → VRHCNLSYWSNPRFARLQQIQTQNLLEPVLRL

Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.
Show »
Length:535
Mass (Da):59,612
Checksum:iE5D83B408D218D8A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti132E → G in BAE98412 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018097504 – 531DIAIS…YWNRY → VRHCNLSYWSNPRFARLQQI QTQNLLEPVLRL in isoform 2. CuratedAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC011664 Genomic DNA Translation: AAF14827.1
CP002686 Genomic DNA Translation: AEE73761.1
CP002686 Genomic DNA Translation: AEE73762.1
AY126990 mRNA Translation: AAM83217.1
BT000830 mRNA Translation: AAN33205.1
BT000662 mRNA Translation: AAN31809.1
BT001915 mRNA Translation: AAN71914.1
AK226251 mRNA Translation: BAE98412.1
Z35354 mRNA Translation: CAA84561.1

NCBI Reference Sequences

More...
RefSeqi
NP_186858.1, NM_111075.3 [Q42290-1]
NP_850500.1, NM_180169.1 [Q42290-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
At.23364
At.69050
At.74786

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT3G02090.1; AT3G02090.1; AT3G02090 [Q42290-1]
AT3G02090.2; AT3G02090.2; AT3G02090 [Q42290-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
821084

Gramene; a comparative resource for plants

More...
Gramenei
AT3G02090.1; AT3G02090.1; AT3G02090 [Q42290-1]
AT3G02090.2; AT3G02090.2; AT3G02090 [Q42290-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT3G02090

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC011664 Genomic DNA Translation: AAF14827.1
CP002686 Genomic DNA Translation: AEE73761.1
CP002686 Genomic DNA Translation: AEE73762.1
AY126990 mRNA Translation: AAM83217.1
BT000830 mRNA Translation: AAN33205.1
BT000662 mRNA Translation: AAN31809.1
BT001915 mRNA Translation: AAN71914.1
AK226251 mRNA Translation: BAE98412.1
Z35354 mRNA Translation: CAA84561.1
RefSeqiNP_186858.1, NM_111075.3 [Q42290-1]
NP_850500.1, NM_180169.1 [Q42290-2]
UniGeneiAt.23364
At.69050
At.74786

3D structure databases

ProteinModelPortaliQ42290
SMRiQ42290
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi6417, 5 interactors
IntActiQ42290, 4 interactors
MINTiQ42290
STRINGi3702.AT3G02090.2

Protein family/group databases

MEROPSiM16.003

Proteomic databases

PaxDbiQ42290
PRIDEiQ42290

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT3G02090.1; AT3G02090.1; AT3G02090 [Q42290-1]
AT3G02090.2; AT3G02090.2; AT3G02090 [Q42290-2]
GeneIDi821084
GrameneiAT3G02090.1; AT3G02090.1; AT3G02090 [Q42290-1]
AT3G02090.2; AT3G02090.2; AT3G02090 [Q42290-2]
KEGGiath:AT3G02090

Organism-specific databases

AraportiAT3G02090
TAIRilocus:2078623 AT3G02090

Phylogenomic databases

eggNOGiKOG0960 Eukaryota
COG0612 LUCA
HOGENOMiHOG000242450
InParanoidiQ42290
KOiK17732
OMAiFQEIREQ
PhylomeDBiQ42290

Enzyme and pathway databases

BioCyciARA:AT3G02090-MONOMER
MetaCyc:AT3G02090-MONOMER

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q42290

Gene expression databases

ExpressionAtlasiQ42290 baseline and differential
GenevisibleiQ42290 AT

Family and domain databases

InterProiView protein in InterPro
IPR011249 Metalloenz_LuxS/M16
IPR011765 Pept_M16_N
IPR001431 Pept_M16_Zn_BS
IPR007863 Peptidase_M16_C
PfamiView protein in Pfam
PF00675 Peptidase_M16, 1 hit
PF05193 Peptidase_M16_C, 1 hit
SUPFAMiSSF63411 SSF63411, 2 hits
PROSITEiView protein in PROSITE
PS00143 INSULINASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPPB_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q42290
Secondary accession number(s): Q0WWT6, Q9SGA7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: January 24, 2006
Last modified: December 5, 2018
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again