Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 95 (18 Sep 2019)
Sequence version 2 (02 Sep 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Vezatin

Gene

Vezt

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a pivotal role in the establishment of adherens junctions and their maintenance in adult life. Required for morphogenesis of the preimplantation embryo, and for the implantation process.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
VezatinCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VeztImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2143698 Vezt

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei140 – 160HelicalSequence analysisAdd BLAST21
Transmembranei162 – 182HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasmic vesicle, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Embryos die at the time of implantation because of a defect in intercellular adhesion.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003492481 – 780VezatinAdd BLAST780

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q3ZK22

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3ZK22

PeptideAtlas

More...
PeptideAtlasi
Q3ZK22

PRoteomics IDEntifications database

More...
PRIDEi
Q3ZK22

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3ZK22

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3ZK22

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q3ZK22

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in developing cochlear hair cells (PubMed:17567809). Isoform 1, isoform 2 and isoform 3 are expressed in testis. In the seminiferous epithelium, present exclusively in the acrosome of spermatids (at protein level).2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Present in oocytes and at every embryonic stage (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000036099 Expressed in 243 organ(s), highest expression level in retina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3ZK22 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3ZK22 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with USH2A (via the cytoplasmic region); the interaction associates VEZT with the USH2 complex at the stereocilia base (PubMed:17567809).

Interacts with myosin MYO7A and the cadherin-catenins complex (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
229587, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000037955

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili430 – 467Sequence analysisAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi32 – 35Poly-Ser4
Compositional biasi704 – 711Poly-Ala8
Compositional biasi764 – 767Poly-Glu4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the vezatin family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHYP Eukaryota
ENOG410YQJU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003290

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154816

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3ZK22

Identification of Orthologs from Complete Genome Data

More...
OMAi
DMDSDFR

Database of Orthologous Groups

More...
OrthoDBi
1379096at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3ZK22

TreeFam database of animal gene trees

More...
TreeFami
TF332269

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026859 Myosin-bd
IPR026858 Vezatin

The PANTHER Classification System

More...
PANTHERi
PTHR15989 PTHR15989, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12632 Vezatin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3ZK22-1) [UniParc]FASTAAdd to basket
Also known as: 2.4

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTPEFDEEVV FENSPLYQYL QDLGHTDFEI CSSSSPKPEK CLTTEGPQPP
60 70 80 90 100
PTRVLQRQGI LLKLTETIKS WTFSSQHSKK DDLLHKLDTG FRLDSLHTIL
110 120 130 140 150
QQEVLLQEDV ELLELLDASI LSAGQPQQES GHLPTLCSLA TPNTWDVSLL
160 170 180 190 200
FAFISLLIMF PTCWIVSSWL VWGIILFLYL IIRVLKLWRT AKLQMTLKKY
210 220 230 240 250
RVRLEDMAAN SRAFTNLVRK SLRLIQETEV ISRGFTLVSA ACSFNKAAQH
260 270 280 290 300
PGQHLIGLRK AVYRTVRANF QAARLATLYM LKNYPLNSES DNVTNYICVV
310 320 330 340 350
PFKELGLGLS EDQISEEEAR NLTDGFSLPA LKVLFQLWVA QSSEFFRRLA
360 370 380 390 400
LLLSTANSPS GPLLTAALLP HHILCDVTQG LPHAHSACLD ELKRSYEFFR
410 420 430 440 450
YFETQHQSVP QRLSKTPQKS RELSNVHTAV RSLQLHLKAL LNEVIILEDE
460 470 480 490 500
LEKLVCTKET QELLSEAYPI LEQKLKLIEP HVQASNSCWE EAISQVDKLL
510 520 530 540 550
RRNTDKKGKP GVACENPHCT AEPLVRPALH IEDRDPIPEE QELEAYVDDI
560 570 580 590 600
DIESEFRKDD FYHLSQEDRE RQKREQEESR RVLQELKSVL GFKASEAERQ
610 620 630 640 650
KWKQLLFSDH AVLTSLSPVD PVESVSNSEP PMNSDTEKVN SNATEEETSK
660 670 680 690 700
PCAGDKEDSR TEYVCDSPTE GPSKDTSADT GLLLPGAEET MCHQHESEAK
710 720 730 740 750
SPQAAAAGAT APPTPRDTLQ LSIKQRLARL QLPPEFTFSA GLAAEVAARS
760 770 780
LSFTTMQEQT FGDEEEEQLV EGGENEVEEK
Length:780
Mass (Da):87,987
Last modified:September 2, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAB8D244A6EDBDCEE
GO
Isoform 2 (identifier: Q3ZK22-2) [UniParc]FASTAAdd to basket
Also known as: 0.8

The sequence of this isoform differs from the canonical sequence as follows:
     239-307: SAACSFNKAAQHPGQHLIGLRKAVYRTVRANFQAARLATLYMLKNYPLNSESDNVTNYICVVPFKELGL → LLR
     311-342: EDQISEEEARNLTDGFSLPALKVLFQLWVAQS → DEWLCAQPVLRQVYQMLGLVSFLTFTHIMDLT
     343-780: Missing.

Show »
Length:276
Mass (Da):31,712
Checksum:i18E37DBFA6B246E7
GO
Isoform 3 (identifier: Q3ZK22-3) [UniParc]FASTAAdd to basket
Also known as: 1.9

The sequence of this isoform differs from the canonical sequence as follows:
     611-617: AVLTSLS → GVKAEWN
     618-780: Missing.

Show »
Length:617
Mass (Da):70,691
Checksum:i7AD4F58552045E42
GO
Isoform 4 (identifier: Q3ZK22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     611-639: AVLTSLSPVDPVESVSNSEPPMNSDTEKV → EWTFNWIHHAGHGGTVIPARWLRQGGSGV
     640-780: Missing.

Note: No experimental confirmation available.
Show »
Length:639
Mass (Da):73,116
Checksum:iFB27883E0CE905C4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z4E6D3Z4E6_MOUSE
Vezatin
Vezt
784Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6TIK3F6TIK3_MOUSE
Vezatin
Vezt
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7CPT8F7CPT8_MOUSE
Vezatin
Vezt
231Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YVB1D3YVB1_MOUSE
Vezatin
Vezt
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6W383F6W383_MOUSE
Vezatin
Vezt
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti57R → K in AAX12552 (PubMed:16199027).Curated1
Sequence conflicti57R → K in AAX12551 (PubMed:16199027).Curated1
Sequence conflicti57R → K in AAY87458 (PubMed:17452094).Curated1
Sequence conflicti74S → P in AAX12552 (PubMed:16199027).Curated1
Sequence conflicti74S → P in AAX12551 (PubMed:16199027).Curated1
Sequence conflicti74S → P in AAY87458 (PubMed:17452094).Curated1
Sequence conflicti177F → L in AAX12552 (PubMed:16199027).Curated1
Sequence conflicti177F → L in AAX12551 (PubMed:16199027).Curated1
Sequence conflicti177F → L in AAY87458 (PubMed:17452094).Curated1
Sequence conflicti358S → T in AAX12552 (PubMed:16199027).Curated1
Sequence conflicti390D → E in AAX12552 (PubMed:16199027).Curated1
Sequence conflicti390D → E in AAX12551 (PubMed:16199027).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_035268239 – 307SAACS…KELGL → LLR in isoform 2. 2 PublicationsAdd BLAST69
Alternative sequenceiVSP_035269311 – 342EDQIS…WVAQS → DEWLCAQPVLRQVYQMLGLV SFLTFTHIMDLT in isoform 2. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_035270343 – 780Missing in isoform 2. 2 PublicationsAdd BLAST438
Alternative sequenceiVSP_035271611 – 639AVLTS…DTEKV → EWTFNWIHHAGHGGTVIPAR WLRQGGSGV in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_035272611 – 617AVLTSLS → GVKAEWN in isoform 3. 1 Publication7
Alternative sequenceiVSP_035273618 – 780Missing in isoform 3. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_035274640 – 780Missing in isoform 4. 1 PublicationAdd BLAST141

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY753561 mRNA Translation: AAX12551.1
AY753562 mRNA Translation: AAX12552.1
DQ025533 mRNA Translation: AAY87458.1
AK036017 mRNA Translation: BAC29277.1
AK041354 mRNA Translation: BAC30915.1
AK042540 mRNA Translation: BAC31287.1
BC056428 mRNA Translation: AAH56428.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36038.1 [Q3ZK22-1]
CCDS78886.1 [Q3ZK22-3]
CCDS83750.1 [Q3ZK22-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001291501.1, NM_001304572.1 [Q3ZK22-3]
NP_001291504.1, NM_001304575.1
NP_001291649.1, NM_001304720.1 [Q3ZK22-4]
NP_766126.2, NM_172538.5 [Q3ZK22-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000047711; ENSMUSP00000037955; ENSMUSG00000036099 [Q3ZK22-1]
ENSMUST00000118077; ENSMUSP00000113983; ENSMUSG00000036099 [Q3ZK22-3]
ENSMUST00000118205; ENSMUSP00000113321; ENSMUSG00000036099 [Q3ZK22-4]
ENSMUST00000150704; ENSMUSP00000121727; ENSMUSG00000036099 [Q3ZK22-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
215008

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:215008

UCSC genome browser

More...
UCSCi
uc007gvh.2 mouse [Q3ZK22-1]
uc007gvi.2 mouse [Q3ZK22-3]
uc007gvj.2 mouse [Q3ZK22-2]
uc056yhx.1 mouse [Q3ZK22-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY753561 mRNA Translation: AAX12551.1
AY753562 mRNA Translation: AAX12552.1
DQ025533 mRNA Translation: AAY87458.1
AK036017 mRNA Translation: BAC29277.1
AK041354 mRNA Translation: BAC30915.1
AK042540 mRNA Translation: BAC31287.1
BC056428 mRNA Translation: AAH56428.1
CCDSiCCDS36038.1 [Q3ZK22-1]
CCDS78886.1 [Q3ZK22-3]
CCDS83750.1 [Q3ZK22-4]
RefSeqiNP_001291501.1, NM_001304572.1 [Q3ZK22-3]
NP_001291504.1, NM_001304575.1
NP_001291649.1, NM_001304720.1 [Q3ZK22-4]
NP_766126.2, NM_172538.5 [Q3ZK22-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi229587, 1 interactor
STRINGi10090.ENSMUSP00000037955

PTM databases

iPTMnetiQ3ZK22
PhosphoSitePlusiQ3ZK22
SwissPalmiQ3ZK22

Proteomic databases

EPDiQ3ZK22
PaxDbiQ3ZK22
PeptideAtlasiQ3ZK22
PRIDEiQ3ZK22

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000047711; ENSMUSP00000037955; ENSMUSG00000036099 [Q3ZK22-1]
ENSMUST00000118077; ENSMUSP00000113983; ENSMUSG00000036099 [Q3ZK22-3]
ENSMUST00000118205; ENSMUSP00000113321; ENSMUSG00000036099 [Q3ZK22-4]
ENSMUST00000150704; ENSMUSP00000121727; ENSMUSG00000036099 [Q3ZK22-2]
GeneIDi215008
KEGGimmu:215008
UCSCiuc007gvh.2 mouse [Q3ZK22-1]
uc007gvi.2 mouse [Q3ZK22-3]
uc007gvj.2 mouse [Q3ZK22-2]
uc056yhx.1 mouse [Q3ZK22-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55591
MGIiMGI:2143698 Vezt

Phylogenomic databases

eggNOGiENOG410IHYP Eukaryota
ENOG410YQJU LUCA
GeneTreeiENSGT00390000003290
HOGENOMiHOG000154816
InParanoidiQ3ZK22
OMAiDMDSDFR
OrthoDBi1379096at2759
PhylomeDBiQ3ZK22
TreeFamiTF332269

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Vezt mouse

Protein Ontology

More...
PROi
PR:Q3ZK22

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000036099 Expressed in 243 organ(s), highest expression level in retina
ExpressionAtlasiQ3ZK22 baseline and differential
GenevisibleiQ3ZK22 MM

Family and domain databases

InterProiView protein in InterPro
IPR026859 Myosin-bd
IPR026858 Vezatin
PANTHERiPTHR15989 PTHR15989, 1 hit
PfamiView protein in Pfam
PF12632 Vezatin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVEZA_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3ZK22
Secondary accession number(s): A0M8X3
, Q3ZK21, Q8BY12, Q8BYB4, Q8BZB5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: September 2, 2008
Last modified: September 18, 2019
This is version 95 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again