Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Breast carcinoma-amplified sequence 1 homolog

Gene

Bcas1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for myelination.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Breast carcinoma-amplified sequence 1 homolog
Alternative name(s):
Protein whose mRNA is enriched in synaptosomes 2
Short name:
Pmes-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Bcas1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Rat genome database

More...
RGDi
628644 Bcas1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002359851 – 589Breast carcinoma-amplified sequence 1 homologAdd BLAST589

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei127PhosphoserineCombined sources1
Modified residuei192PhosphoserineCombined sources1
Modified residuei314PhosphoserineCombined sources1
Modified residuei381PhosphoserineBy similarity1
Modified residuei480PhosphothreonineCombined sources1
Modified residuei482PhosphoserineCombined sources1
Modified residuei557PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3ZB98

PRoteomics IDEntifications database

More...
PRIDEi
Q3ZB98

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3ZB98

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q3ZB98

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in cerebral cortex and cerebellum, but not in other organs.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000012906 Expressed in 6 organ(s), highest expression level in Ammon's horn

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3ZB98 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity). Interacts with DYNLL1 and DYNLL2 (PubMed:16133941).By similarity1 Publication

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni570 – 589Interacts with DYNLL1 AND DYNLL21 PublicationAdd BLAST20

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJ5W Eukaryota
ENOG41119UT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003167

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG082347

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3ZB98

Identification of Orthologs from Complete Genome Data

More...
OMAi
TQGAAKN

Database of Orthologous Groups

More...
OrthoDBi
1009953at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3ZB98

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026115 NABC1

The PANTHER Classification System

More...
PANTHERi
PTHR15016 PTHR15016, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3ZB98-1) [UniParc]FASTAAdd to basket
Also known as: PMES-2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNQMSVPLR PGDQEHDPEA DTYKVTSDNE CVQNGIPVVV STRVIQHYEE
60 70 80 90 100
VDLGINSLKD NVPASSPETM EAHAVADASG KNLGKGSKPK APAARSHFFL
110 120 130 140 150
TLSRPVPGRP GDQGTDSSAA SGRLDVSPGT APENKDPSEH GALPVAAAPG
160 170 180 190 200
PAPDKTPGCT EAKQQTLPAT SPLAPSPPES QAEAPSRPKD FSFLNRLFKL
210 220 230 240 250
DKGRESAPAD SPPEEGKGSK SQERAIEAPA VPGNPHGVSA GKDIVDSEER
260 270 280 290 300
KQEVDTLSYS VPADPEVLGT TKEDPQVVDA TENSNSIMSF FKTLVSPNKT
310 320 330 340 350
ETKKDPEDTD AENSPTTPAN LKSDKADLTP QETQGTAKSS KGSSQPGQAP
360 370 380 390 400
SAGTSDTARE GGKEKAGPTS LPLGKLFWKK SVKEDSLSTG AEENAVCEPP
410 420 430 440 450
VETVRLEEVE STLQTVDLTE KETQTEPTDV KVKEESKPRR TPLMAFLRQM
460 470 480 490 500
SVRGSEGITR SEESNGKDSS CQTSNSTEKT PSPPEPEPAG TAQKNKETSS
510 520 530 540 550
KDKKSVDKKS AAESNKQKNG KPEAREPAPC VQQPTVEVNA LQTGDKTPKR
560 570 580
SEKRRQSLGG FLKGLGPKRM LDAQVQTDPV SIGPVGKSK
Length:589
Mass (Da):62,382
Last modified:October 10, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6919B3C87C0898F6
GO
Isoform 2 (identifier: Q3ZB98-2) [UniParc]FASTAAdd to basket
Also known as: PMES-2E

The sequence of this isoform differs from the canonical sequence as follows:
     395-450: Missing.

Show »
Length:533
Mass (Da):55,956
Checksum:i3B193E82C94B66B9
GO
Isoform 3 (identifier: Q3ZB98-3) [UniParc]FASTAAdd to basket
Also known as: PMES-2C

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: T → MKATKADSVCDGHAGQKMSETQAKSKKKRLDSPRLGLSFRKFFRHK
     395-472: Missing.

Show »
Length:556
Mass (Da):58,778
Checksum:i73AFA3CA81DE6034
GO
Isoform 4 (identifier: Q3ZB98-4) [UniParc]FASTAAdd to basket
Also known as: PMES-2D

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: T → MKATKADSVCDGHAGQKMSETQAKSKKKRLDSPRLGLSFRKFFRHK
     381-472: Missing.

Show »
Length:542
Mass (Da):57,331
Checksum:i005EC6CF00F85869
GO
Isoform 5 (identifier: Q3ZB98-5) [UniParc]FASTAAdd to basket
Also known as: PMES-2B

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: T → MKATKADSVCDGHAGQKMSETQAKSKKKRLDSPRLGLSFRKFFRHK

Show »
Length:634
Mass (Da):67,500
Checksum:i044D01516ED1539E
GO
Isoform 6 (identifier: Q3ZB98-6) [UniParc]FASTAAdd to basket
Also known as: band83

The sequence of this isoform differs from the canonical sequence as follows:
     309-309: T → MKATKADSVCDGHAGQKMSETQAKSKKKRLDSPRLGLSFRKFFRHK
     395-450: Missing.

Show »
Length:578
Mass (Da):61,073
Checksum:iCE18EF3D8A1BD3F7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2K079A0A0G2K079_RAT
Breast carcinoma-amplified sequence...
Bcas1
347Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC01271 differs from that shown. Reason: Frameshift at position 167.Curated
The sequence BAC01271 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD69785 differs from that shown. Reason: Frameshift at position 167.Curated
The sequence BAD69785 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD69786 differs from that shown. Reason: Frameshift at position 167.Curated
The sequence BAD69786 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD69787 differs from that shown. Reason: Frameshift at position 167.Curated
The sequence BAD69787 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD69788 differs from that shown. Reason: Frameshift at position 167.Curated
The sequence BAD69788 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti309T → M in BAD69788 (PubMed:16133941).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018548309T → MKATKADSVCDGHAGQKMSE TQAKSKKKRLDSPRLGLSFR KFFRHK in isoform 3, isoform 4, isoform 5 and isoform 6. 3 Publications1
Alternative sequenceiVSP_018549381 – 472Missing in isoform 4. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_018550395 – 472Missing in isoform 3. 2 PublicationsAdd BLAST78
Alternative sequenceiVSP_018551395 – 450Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AABR07054732 Genomic DNA No translation available.
BC094306 mRNA Translation: AAH94306.1
BC103480 mRNA Translation: AAI03481.1
AB029897 mRNA Translation: BAC01271.1 Sequence problems.
AB180269 mRNA Translation: BAD69785.1 Sequence problems.
AB180270 mRNA Translation: BAD69786.1 Sequence problems.
AB180271 mRNA Translation: BAD69787.1 Sequence problems.
AB180272 mRNA Translation: BAD69788.1 Sequence problems.

NCBI Reference Sequences

More...
RefSeqi
NP_663703.3, NM_145670.4 [Q3ZB98-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Rn.154429

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000055111; ENSRNOP00000051984; ENSRNOG00000012906 [Q3ZB98-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
246755

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:246755

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR07054732 Genomic DNA No translation available.
BC094306 mRNA Translation: AAH94306.1
BC103480 mRNA Translation: AAI03481.1
AB029897 mRNA Translation: BAC01271.1 Sequence problems.
AB180269 mRNA Translation: BAD69785.1 Sequence problems.
AB180270 mRNA Translation: BAD69786.1 Sequence problems.
AB180271 mRNA Translation: BAD69787.1 Sequence problems.
AB180272 mRNA Translation: BAD69788.1 Sequence problems.
RefSeqiNP_663703.3, NM_145670.4 [Q3ZB98-1]
UniGeneiRn.154429

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

PTM databases

iPTMnetiQ3ZB98
SwissPalmiQ3ZB98

Proteomic databases

PaxDbiQ3ZB98
PRIDEiQ3ZB98

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000055111; ENSRNOP00000051984; ENSRNOG00000012906 [Q3ZB98-1]
GeneIDi246755
KEGGirno:246755

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8537
RGDi628644 Bcas1

Phylogenomic databases

eggNOGiENOG410IJ5W Eukaryota
ENOG41119UT LUCA
GeneTreeiENSGT00390000003167
HOVERGENiHBG082347
InParanoidiQ3ZB98
OMAiTQGAAKN
OrthoDBi1009953at2759
PhylomeDBiQ3ZB98

Gene expression databases

BgeeiENSRNOG00000012906 Expressed in 6 organ(s), highest expression level in Ammon's horn
ExpressionAtlasiQ3ZB98 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR026115 NABC1
PANTHERiPTHR15016 PTHR15016, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBCAS1_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3ZB98
Secondary accession number(s): F1LN49
, Q52KK0, Q5TLG8, Q5TLG9, Q5TLH0, Q5TLH1, Q8K4U9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 10, 2018
Last modified: January 16, 2019
This is version 73 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again