Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (11 Dec 2019)
Sequence version 2 (29 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B

Gene

MGAT5B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAc-beta1,2-Man-alpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAc-beta1,2-Man-alpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+2 Publications

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.56 mM for UDP-GlcNAc1 Publication

    pH dependencei

    Optimum pH is 8.0.1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

    This protein is involved in the pathway protein glycosylation, which is part of Protein modification.4 Publications
    View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionGlycosyltransferase, Transferase
    LigandManganese, Metal-binding

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    MetaCyc:HS15606-MONOMER

    SIGNOR Signaling Network Open Resource

    More...
    SIGNORi
    Q3V5L5

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...
    UniPathwayi
    UPA00378

    Protein family/group databases

    Carbohydrate-Active enZymes

    More...
    CAZyi
    GT18 Glycosyltransferase Family 18

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B (EC:2.4.1.-1 Publication, EC:2.4.1.1553 Publications)
    Alternative name(s):
    Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B
    GlcNAc-T Vb1 Publication
    Short name:
    GNT-Vb2 Publications
    Short name:
    hGnTVb
    Mannoside acetylglucosaminyltransferase 5B
    N-acetylglucosaminyl-transferase Vb
    N-acetylglucosaminyltransferase IX1 Publication
    Short name:
    GNT-IX1 Publication
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:MGAT5B
    Synonyms:KIAA2008
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000167889.12

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:24140 MGAT5B

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    612441 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q3V5L5

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 24CytoplasmicSequence analysisAdd BLAST24
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei25 – 45Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
    Topological domaini46 – 792LumenalSequence analysisAdd BLAST747

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    146664

    Open Targets

    More...
    OpenTargetsi
    ENSG00000167889

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA134987427

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q3V5L5 Tbio

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    MGAT5B

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    152040009

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002886111 – 792Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase BAdd BLAST792

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi127N-linked (GlcNAc...) asparagineSequence analysis1
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi157 ↔ 195By similarity
    Disulfide bondi168 ↔ 208By similarity
    Disulfide bondi184 ↔ 353By similarity
    Disulfide bondi387 ↔ 644By similarity
    Disulfide bondi700 ↔ 775By similarity
    Disulfide bondi704 ↔ 777By similarity
    Disulfide bondi711 ↔ 764By similarity
    Disulfide bondi732 ↔ 753By similarity
    Disulfide bondi788 ↔ 791By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q3V5L5

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q3V5L5

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q3V5L5

    PeptideAtlas

    More...
    PeptideAtlasi
    Q3V5L5

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q3V5L5

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    61881 [Q3V5L5-1]
    61882 [Q3V5L5-2]
    61885 [Q3V5L5-5]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q3V5L5

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q3V5L5

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Predominantly expressed in brain. Expressed in all area of the adult and fetal brain Also expressed at much lower level in testis, spleen and thymus.2 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000167889 Expressed in 111 organ(s), highest expression level in right frontal lobe

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q3V5L5 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q3V5L5 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA011082

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    WithEntry#Exp.IntActNotes
    P090223EBI-3957727,EBI-3957603From Mus musculus.

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    127000, 24 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q3V5L5, 3 interactors

    Molecular INTeraction database

    More...
    MINTi
    Q3V5L5

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000391227

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    Q3V5L5 protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q3V5L5

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the glycosyltransferase 18 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    ENOG410IDYS Eukaryota
    ENOG410XTV7 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000153470

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000006557

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q3V5L5

    KEGG Orthology (KO)

    More...
    KOi
    K09661

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    ASIWKFQ

    Database of Orthologous Groups

    More...
    OrthoDBi
    179031at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q3V5L5

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF313714

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR026116 GlyclTrfase_18

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF15024 Glyco_transf_18, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q3V5L5-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MITVNPDGKI MVRRCLVTLR PFRLFVLGIG FFTLCFLMTS LGGQFSARRL
    60 70 80 90 100
    GDSPFTIRTE VMGGPESRGV LRKMSDLLEL MVKRMDALAR LENSSELHRA
    110 120 130 140 150
    GGDLHFPADR MPPGAGLMER IQAIAQNVSD IAVKVDQILR HSLLLHSKVS
    160 170 180 190 200
    EGRRDQCEAP SDPKFPDCSG KVEWMRARWT SDPCYAFFGV DGTECSFLIY
    210 220 230 240 250
    LSEVEWFCPP LPWRNQTAAQ RAPKPLPKVQ AVFRSNLSHL LDLMGSGKES
    260 270 280 290 300
    LIFMKKRTKR LTAQWALAAQ RLAQKLGATQ RDQKQILVHI GFLTEESGDV
    310 320 330 340 350
    FSPRVLKGGP LGEMVQWADI LTALYVLGHG LRVTVSLKEL QSNLGVPPGR
    360 370 380 390 400
    GSCPLTMPLP FDLIYTDYHG LQQMKRHMGL SFKKYRCRIR VIDTFGTEPA
    410 420 430 440 450
    YNHEEYATLH GYRTNWGYWN LNPKQFMTMF PHTPDNSFMG FVSEELNETE
    460 470 480 490 500
    KRLIKGGKAS NMAVVYGKEA SIWKLQGKEK FLGILNKYME IHGTVYYESQ
    510 520 530 540 550
    RPPEVPAFVK NHGLLPQPEF QQLLRKAKLF IGFGFPYEGP APLEAIANGC
    560 570 580 590 600
    IFLQSRFSPP HSSLNHEFFR GKPTSREVFS QHPYAENFIG KPHVWTVDYN
    610 620 630 640 650
    NSEEFEAAIK AIMRTQVDPY LPYEYTCEGM LERIHAYIQH QDFCRAPDPA
    660 670 680 690 700
    LPEAHAPQSP FVLAPNATHL EWARNTSLAP GAWPPAHALR AWLAVPGRAC
    710 720 730 740 750
    TDTCLDHGLI CEPSFFPFLN SQDAFLKLQV PCDSTESEMN HLYPAFAQPG
    760 770 780 790
    QECYLQKEPL LFSCAGSNTK YRRLCPCRDF RKGQVALCQG CL
    Length:792
    Mass (Da):89,535
    Last modified:May 29, 2007 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC2EB9445FDBE9429
    GO
    Isoform 2 (identifier: Q3V5L5-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: MITVNPDGKIMVRRCLVTLRPF → MHSFVKHLCSRYVVERQGTMALPALLTRLLPLR
         475-476: Missing.

    Show »
    Length:801
    Mass (Da):90,571
    Checksum:iB5EC03A96DBFB38B
    GO
    Isoform 3 (identifier: Q3V5L5-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         475-476: Missing.

    Show »
    Length:790
    Mass (Da):89,294
    Checksum:i22193B688EFFACFF
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    H3BQ65H3BQ65_HUMAN
    Alpha-1,6-mannosylglycoprotein 6-be...
    MGAT5B
    483Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H3BR20H3BR20_HUMAN
    Alpha-1,6-mannosylglycoprotein 6-be...
    MGAT5B
    110Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAH62354 differs from that shown. Probable cloning artifact.Curated
    The sequence AAH63862 differs from that shown. Probable cloning artifact.Curated
    The sequence BAB71598 differs from that shown. Chimeric sequence.Curated
    The sequence BAD02406 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
    The sequence BAE44474 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03245270V → I. Corresponds to variant dbSNP:rs571264Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0257311 – 22MITVN…TLRPF → MHSFVKHLCSRYVVERQGTM ALPALLTRLLPLR in isoform 2. 1 PublicationAdd BLAST22
    Alternative sequenceiVSP_025734475 – 476Missing in isoform 2 and isoform 3. 1 Publication2

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AB114297 mRNA Translation: BAD02406.1 Different initiation.
    AB109185 mRNA Translation: BAC84969.1
    AB235153 mRNA Translation: BAE44474.1 Different initiation.
    AC016168 Genomic DNA No translation available.
    BC062354 mRNA Translation: AAH62354.1 Sequence problems.
    BC063862 mRNA Translation: AAH63862.1 Sequence problems.
    AK057861 mRNA Translation: BAB71598.1 Sequence problems.

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS11751.1 [Q3V5L5-5]
    CCDS45788.1 [Q3V5L5-2]
    CCDS59299.1 [Q3V5L5-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001186101.1, NM_001199172.1 [Q3V5L5-1]
    NP_653278.2, NM_144677.2 [Q3V5L5-5]
    NP_945193.1, NM_198955.1 [Q3V5L5-2]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000301618; ENSP00000301618; ENSG00000167889 [Q3V5L5-5]
    ENST00000428789; ENSP00000391227; ENSG00000167889 [Q3V5L5-2]
    ENST00000569840; ENSP00000456037; ENSG00000167889 [Q3V5L5-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    146664

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:146664

    UCSC genome browser

    More...
    UCSCi
    uc002jth.4 human [Q3V5L5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB114297 mRNA Translation: BAD02406.1 Different initiation.
    AB109185 mRNA Translation: BAC84969.1
    AB235153 mRNA Translation: BAE44474.1 Different initiation.
    AC016168 Genomic DNA No translation available.
    BC062354 mRNA Translation: AAH62354.1 Sequence problems.
    BC063862 mRNA Translation: AAH63862.1 Sequence problems.
    AK057861 mRNA Translation: BAB71598.1 Sequence problems.
    CCDSiCCDS11751.1 [Q3V5L5-5]
    CCDS45788.1 [Q3V5L5-2]
    CCDS59299.1 [Q3V5L5-1]
    RefSeqiNP_001186101.1, NM_001199172.1 [Q3V5L5-1]
    NP_653278.2, NM_144677.2 [Q3V5L5-5]
    NP_945193.1, NM_198955.1 [Q3V5L5-2]

    3D structure databases

    SMRiQ3V5L5
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi127000, 24 interactors
    IntActiQ3V5L5, 3 interactors
    MINTiQ3V5L5
    STRINGi9606.ENSP00000391227

    Protein family/group databases

    CAZyiGT18 Glycosyltransferase Family 18

    PTM databases

    iPTMnetiQ3V5L5
    PhosphoSitePlusiQ3V5L5

    Polymorphism and mutation databases

    BioMutaiMGAT5B
    DMDMi152040009

    Proteomic databases

    MassIVEiQ3V5L5
    MaxQBiQ3V5L5
    PaxDbiQ3V5L5
    PeptideAtlasiQ3V5L5
    PRIDEiQ3V5L5
    ProteomicsDBi61881 [Q3V5L5-1]
    61882 [Q3V5L5-2]
    61885 [Q3V5L5-5]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    146664

    Genome annotation databases

    EnsembliENST00000301618; ENSP00000301618; ENSG00000167889 [Q3V5L5-5]
    ENST00000428789; ENSP00000391227; ENSG00000167889 [Q3V5L5-2]
    ENST00000569840; ENSP00000456037; ENSG00000167889 [Q3V5L5-1]
    GeneIDi146664
    KEGGihsa:146664
    UCSCiuc002jth.4 human [Q3V5L5-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    146664
    DisGeNETi146664
    EuPathDBiHostDB:ENSG00000167889.12

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    MGAT5B
    HGNCiHGNC:24140 MGAT5B
    HPAiHPA011082
    MIMi612441 gene
    neXtProtiNX_Q3V5L5
    OpenTargetsiENSG00000167889
    PharmGKBiPA134987427

    Human Unidentified Gene-Encoded large proteins database

    More...
    HUGEi
    Search...

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiENOG410IDYS Eukaryota
    ENOG410XTV7 LUCA
    GeneTreeiENSGT00940000153470
    HOGENOMiHOG000006557
    InParanoidiQ3V5L5
    KOiK09661
    OMAiASIWKFQ
    OrthoDBi179031at2759
    PhylomeDBiQ3V5L5
    TreeFamiTF313714

    Enzyme and pathway databases

    UniPathwayiUPA00378
    BioCyciMetaCyc:HS15606-MONOMER
    SIGNORiQ3V5L5

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    MGAT5B human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    MGAT5B

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    146664
    PharosiQ3V5L5 Tbio

    Protein Ontology

    More...
    PROi
    PR:Q3V5L5
    RNActiQ3V5L5 protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000167889 Expressed in 111 organ(s), highest expression level in right frontal lobe
    ExpressionAtlasiQ3V5L5 baseline and differential
    GenevisibleiQ3V5L5 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR026116 GlyclTrfase_18
    PfamiView protein in Pfam
    PF15024 Glyco_transf_18, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMGT5B_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3V5L5
    Secondary accession number(s): Q6P3S8
    , Q6P6B3, Q766X5, Q76D04, Q96LS2
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 29, 2007
    Last modified: December 11, 2019
    This is version 121 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again