Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B

Gene

MGAT5B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.5 Publications

Catalytic activityi

UDP-N-acetyl-alpha-D-glucosamine + beta-D-GlcNAc-(1->2)-(beta-D-GlcNAc-(1->4))-alpha-D-Man-(1->3)-(beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6))-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc-N-Asn-[protein] = UDP + beta-D-GlcNAc-(1->2)-(beta-D-GlcNAc-(1->4))-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-(beta-D-GlcNAc-(1->6))-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc-N-Asn-[protein].2 Publications
UDP-N-acetyl-alpha-D-glucosamine + O3-[beta-D-GlcNAc-(1->2)-alpha-D-Man]-L-Ser-[protein] = UDP + O3-[beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->6)]-alpha-D-Man]-L-Ser-[protein].2 Publications
UDP-N-acetyl-alpha-D-glucosamine + O3-[beta-D-GlcNAc-(1->2)-alpha-D-Man]-L-Thr-[protein] = UDP + O3-[beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->6)]-alpha-D-Man]-L-Thr-[protein].2 Publications

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGlycosyltransferase, Transferase
LigandMetal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS15606-MONOMER
SIGNORiQ3V5L5
UniPathwayiUPA00378

Protein family/group databases

CAZyiGT18 Glycosyltransferase Family 18

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B (EC:2.4.1.-, EC:2.4.1.1552 Publications)
Alternative name(s):
Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B
GlcNAc-T Vb
Short name:
GNT-Vb
Short name:
hGnTVb
Mannoside acetylglucosaminyltransferase 5B
N-acetylglucosaminyl-transferase Vb
N-acetylglucosaminyltransferase IX
Short name:
GNT-IX
Gene namesi
Name:MGAT5B
Synonyms:KIAA2008
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000167889.12
HGNCiHGNC:24140 MGAT5B
MIMi612441 gene
neXtProtiNX_Q3V5L5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 24CytoplasmicSequence analysisAdd BLAST24
Transmembranei25 – 45Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini46 – 792LumenalSequence analysisAdd BLAST747

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi146664
OpenTargetsiENSG00000167889
PharmGKBiPA134987427

Polymorphism and mutation databases

BioMutaiMGAT5B
DMDMi152040009

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002886111 – 792Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase BAdd BLAST792

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi127N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ3V5L5
PaxDbiQ3V5L5
PeptideAtlasiQ3V5L5
PRIDEiQ3V5L5
ProteomicsDBi61881
61882 [Q3V5L5-2]
61885 [Q3V5L5-5]

PTM databases

iPTMnetiQ3V5L5
PhosphoSitePlusiQ3V5L5

Expressioni

Tissue specificityi

Predominantly expressed in brain. Expressed in all area of the adult and fetal brain Also expressed at much lower level in testis, spleen and thymus.2 Publications

Gene expression databases

BgeeiENSG00000167889
CleanExiHS_MGAT5B
ExpressionAtlasiQ3V5L5 baseline and differential
GenevisibleiQ3V5L5 HS

Organism-specific databases

HPAiHPA011082

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Hoxa1P090223EBI-3957727,EBI-3957603From Mus musculus.

Protein-protein interaction databases

BioGridi127000, 23 interactors
IntActiQ3V5L5, 2 interactors
MINTiQ3V5L5
STRINGi9606.ENSP00000391227

Structurei

3D structure databases

ProteinModelPortaliQ3V5L5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 18 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IDYS Eukaryota
ENOG410XTV7 LUCA
GeneTreeiENSGT00390000012263
HOGENOMiHOG000006557
HOVERGENiHBG052469
InParanoidiQ3V5L5
KOiK09661
OMAiQVDPYLP
OrthoDBiEOG091G044F
PhylomeDBiQ3V5L5
TreeFamiTF313714

Family and domain databases

InterProiView protein in InterPro
IPR026116 GlyclTrfase_18
PANTHERiPTHR15075 PTHR15075, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3V5L5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MITVNPDGKI MVRRCLVTLR PFRLFVLGIG FFTLCFLMTS LGGQFSARRL
60 70 80 90 100
GDSPFTIRTE VMGGPESRGV LRKMSDLLEL MVKRMDALAR LENSSELHRA
110 120 130 140 150
GGDLHFPADR MPPGAGLMER IQAIAQNVSD IAVKVDQILR HSLLLHSKVS
160 170 180 190 200
EGRRDQCEAP SDPKFPDCSG KVEWMRARWT SDPCYAFFGV DGTECSFLIY
210 220 230 240 250
LSEVEWFCPP LPWRNQTAAQ RAPKPLPKVQ AVFRSNLSHL LDLMGSGKES
260 270 280 290 300
LIFMKKRTKR LTAQWALAAQ RLAQKLGATQ RDQKQILVHI GFLTEESGDV
310 320 330 340 350
FSPRVLKGGP LGEMVQWADI LTALYVLGHG LRVTVSLKEL QSNLGVPPGR
360 370 380 390 400
GSCPLTMPLP FDLIYTDYHG LQQMKRHMGL SFKKYRCRIR VIDTFGTEPA
410 420 430 440 450
YNHEEYATLH GYRTNWGYWN LNPKQFMTMF PHTPDNSFMG FVSEELNETE
460 470 480 490 500
KRLIKGGKAS NMAVVYGKEA SIWKLQGKEK FLGILNKYME IHGTVYYESQ
510 520 530 540 550
RPPEVPAFVK NHGLLPQPEF QQLLRKAKLF IGFGFPYEGP APLEAIANGC
560 570 580 590 600
IFLQSRFSPP HSSLNHEFFR GKPTSREVFS QHPYAENFIG KPHVWTVDYN
610 620 630 640 650
NSEEFEAAIK AIMRTQVDPY LPYEYTCEGM LERIHAYIQH QDFCRAPDPA
660 670 680 690 700
LPEAHAPQSP FVLAPNATHL EWARNTSLAP GAWPPAHALR AWLAVPGRAC
710 720 730 740 750
TDTCLDHGLI CEPSFFPFLN SQDAFLKLQV PCDSTESEMN HLYPAFAQPG
760 770 780 790
QECYLQKEPL LFSCAGSNTK YRRLCPCRDF RKGQVALCQG CL
Length:792
Mass (Da):89,535
Last modified:May 29, 2007 - v2
Checksum:iC2EB9445FDBE9429
GO
Isoform 2 (identifier: Q3V5L5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MITVNPDGKIMVRRCLVTLRPF → MHSFVKHLCSRYVVERQGTMALPALLTRLLPLR
     475-476: Missing.

Show »
Length:801
Mass (Da):90,571
Checksum:iB5EC03A96DBFB38B
GO
Isoform 3 (identifier: Q3V5L5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     475-476: Missing.

Show »
Length:790
Mass (Da):89,294
Checksum:i22193B688EFFACFF
GO

Sequence cautioni

The sequence AAH62354 differs from that shown. Probable cloning artifact.Curated
The sequence AAH63862 differs from that shown. Probable cloning artifact.Curated
The sequence BAB71598 differs from that shown. Chimeric sequence.Curated
The sequence BAD02406 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAE44474 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03245270V → I. Corresponds to variant dbSNP:rs571264Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0257311 – 22MITVN…TLRPF → MHSFVKHLCSRYVVERQGTM ALPALLTRLLPLR in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_025734475 – 476Missing in isoform 2 and isoform 3. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB114297 mRNA Translation: BAD02406.1 Different initiation.
AB109185 mRNA Translation: BAC84969.1
AB235153 mRNA Translation: BAE44474.1 Different initiation.
AC016168 Genomic DNA No translation available.
BC062354 mRNA Translation: AAH62354.1 Sequence problems.
BC063862 mRNA Translation: AAH63862.1 Sequence problems.
AK057861 mRNA Translation: BAB71598.1 Sequence problems.
CCDSiCCDS11751.1 [Q3V5L5-5]
CCDS45788.1 [Q3V5L5-2]
CCDS59299.1 [Q3V5L5-1]
RefSeqiNP_001186101.1, NM_001199172.1 [Q3V5L5-1]
NP_653278.2, NM_144677.2 [Q3V5L5-5]
NP_945193.1, NM_198955.1 [Q3V5L5-2]
UniGeneiHs.144531

Genome annotation databases

EnsembliENST00000301618; ENSP00000301618; ENSG00000167889 [Q3V5L5-5]
ENST00000428789; ENSP00000391227; ENSG00000167889 [Q3V5L5-2]
ENST00000569840; ENSP00000456037; ENSG00000167889 [Q3V5L5-1]
GeneIDi146664
KEGGihsa:146664
UCSCiuc002jth.4 human [Q3V5L5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMGT5B_HUMAN
AccessioniPrimary (citable) accession number: Q3V5L5
Secondary accession number(s): Q6P3S8
, Q6P6B3, Q766X5, Q76D04, Q96LS2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: June 20, 2018
This is version 111 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health