Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (12 Aug 2020)
Sequence version 2 (19 Sep 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Serine/threonine-protein kinase ULK4

Gene

Ulk4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in the remodeling of cytoskeletal components, such as alpha-tubulin, and in this way regulates neurite branching and elongation, as well as cell motility.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei121Proton acceptorPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase ULK4 (EC:2.7.11.1)
Alternative name(s):
Unc-51-like kinase 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ulk4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1921622, Ulk4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Knockout mice are smaller than sex-matched littermates, and all exhibit domed heads typical of hydrocephalus. The majority die before reaching 4 months of age. Brain lateral and third ventricles are severaly dilated with frequent hemorrhage, sometimes accompanied by fibrosis and neovascularization of the meninges and choroid. Nasal passages and maxillary sinuses are partially filled with varying combinations of proteinaceous fluid or suppurative exudates. Suppurative otitis media is frequently observed. On the respiratory epithelium and ependymal cells lining the dilated ventricles, cilia are shorter than those in wild-type littermate control mice (PubMed:21746835). Partial agenesis of the corpus callosum has also been reported (PubMed:24284070).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002501541 – 1303Serine/threonine-protein kinase ULK4Add BLAST1303

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3V129

PRoteomics IDEntifications database

More...
PRIDEi
Q3V129

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3V129

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in embryonic and adult brain. In the brain, widely expressed, with highest levels in layers II/III and V of the cortex, piriform cortex, CA1-3 of hippocampus, dentate gyrus, ependymal cells lining the ventricles and choroid plexus, and in the thalamic reticular nucleus (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000040936, Expressed in spermatid and 123 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3V129, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3V129, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000131342

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3V129, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 280Protein kinasePROSITE-ProRule annotationAdd BLAST277
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati504 – 543HEAT 1Add BLAST40
Repeati727 – 765HEAT 2Add BLAST39
Repeati796 – 834HEAT 3Add BLAST39
Repeati926 – 964HEAT 4Add BLAST39
Repeati1025 – 1063HEAT 5Add BLAST39
Repeati1105 – 1143HEAT 6Add BLAST39
Repeati1151 – 1189HEAT 7Add BLAST39

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1147 – 1150Poly-Leu4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0597, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156541

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002110_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3V129

KEGG Orthology (KO)

More...
KOi
K17545

Database of Orthologous Groups

More...
OrthoDBi
219167at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3V129

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989, ARM-like
IPR016024, ARM-type_fold
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069, Pkinase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371, SSF48371, 1 hit
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011, PROTEIN_KINASE_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3V129-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MENFVLYEEI GRGSRTVVYK GRRKGTINFV AILCTEKCKR PEITNWVRLT
60 70 80 90 100
HEIKHKNIVT FHEWYETSNH LWLVVELCTG GSLETVIAQD ENLPEDVVRE
110 120 130 140 150
FGVDLVTGLH HLHRLGILFC DLSPGKILLE GPGTLKFSNF CLAKVAGESL
160 170 180 190 200
EEFFALVAAE EGGGDSGENA LKKSMKTRVR GSLIYAAPEI VKGTEFSVTS
210 220 230 240 250
DLWSLGCLLY EMFSGKPPFF SETVSELVEK ILYEDPLPPI PKDSSFPKAS
260 270 280 290 300
SDFLNLLDGL LQKDPQKRFS WEGVLQHPFW KDALRGEDSG WASEDSPFSR
310 320 330 340 350
NVMECSGPHD SRELLQSPKN GQAKGQKAAH RLSQSFRLEN PTELRPKSIM
360 370 380 390 400
GGQLNESIFL LSSRPTPRTS AMVELNPGEG EDPSSPQKTS PLSKMTSGHL
410 420 430 440 450
SQGALESQMR ELIYTDSDLV ITPIIDNPKI MKQPAIKFDP KILHLPAYSV
460 470 480 490 500
EKLLVLKDQD WNDFLQQVCS QIDSSEKSTG ALRAKLNLLC YLCVVATHKE
510 520 530 540 550
VATRLLHSPL FQLLIQHLRI APNWDIRSKV ARVVGMLALH TTELQENVPV
560 570 580 590 600
IEAITLLTEL IRENFRSGKL KQCLLPTLGQ LLYLVATQEE KNQHSRDCWA
610 620 630 640 650
VPLAAYTVLM RCLREGEERV VNHMAAKIIE NVCTTFSAQA QGFTTGEIGP
660 670 680 690 700
VLWHLFRHST VDALRITAIS ALCRITRQSP TAFQNVIEKV GLNAVISSLA
710 720 730 740 750
SAICKVQQYM LTLFTAMLSC GIHLQRLIQE KDFVSTVIRL LDSPSTPIRA
760 770 780 790 800
KAFLVLLYIL IHNRDMLLLS CQARLVMYIE RDSRKTSPGK EQQSGNEYLA
810 820 830 840 850
RCLDLLIQHM VQEPPRILGD ILNALANVSG RKHPSTVQGK QLKMCLPMMP
860 870 880 890 900
VVLHLVMSQV FRPQVVTEEF LFSYGTILSH IKSIDLGETN IDGAIGIVAS
910 920 930 940 950
EEFIKVTLSA FEAVIQYPVL LADYRSTVMD YILPPLVSLV QSQNVEWRLF
960 970 980 990 1000
SLRLLSETTT LLVSQEPEDG DEEASCDSDS SLLALIRDEL LPQYEHILME
1010 1020 1030 1040 1050
PDPVPAYALK LLVAMTEHNP AFTRLVEESK LVPLIFEVIL EHQESILGNT
1060 1070 1080 1090 1100
MQSVIALLNN LVAYKDSNMQ LLYEQGLVGH VCNMFTETAT LCLDRDNKTN
1110 1120 1130 1140 1150
TEPASTLLAS LLDILLGMLT YTSRIVRQAL QVQKSGSRGD TQAAEDLLLL
1160 1170 1180 1190 1200
SKPLTDLISL LIPLLPSEDP EISEVSSKCL SILVQLYGGE NPESLSPENM
1210 1220 1230 1240 1250
VTFANLLMTK EDPKDQKLLL RILKRMVTSN ERLLESLKNT GSLLQALERL
1260 1270 1280 1290 1300
APAHRLRGPW AGISCALFQQ RAAAQGIPEL PPYGIPCCGP SHKRVTGVKL

YPC
Length:1,303
Mass (Da):145,342
Last modified:September 19, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD875519D87A21672
GO
Isoform 2 (identifier: Q3V129-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-530: RSKV → LLYV
     531-1303: Missing.

Show »
Length:530
Mass (Da):59,388
Checksum:iD1BB61AFDE3940B9
GO
Isoform 3 (identifier: Q3V129-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     879-910: SHIKSIDLGETNIDGAIGIVASEEFIKVTLSA → VSSRSHVWPAPLPWLQHGCEKGGIERLSGICL
     911-1303: Missing.

Show »
Length:910
Mass (Da):101,938
Checksum:iA602520F381A0ECD
GO
Isoform 4 (identifier: Q3V129-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-430: Missing.
     775-835: LVMYIERDSR...ANVSGRKHPS → RHSQRPGKRV...SLQLRNYSCE
     836-1303: Missing.

Show »
Length:405
Mass (Da):45,214
Checksum:iB5D9C45ABA693FFB
GO
Isoform 5 (identifier: Q3V129-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1050: Missing.

Show »
Length:253
Mass (Da):27,756
Checksum:i10B530B39FED6E38
GO
Isoform 6 (identifier: Q3V129-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1165-1185: LPSEDPEISEVSSKCLSILVQ → VRAHLCASAEVQRLKQFYLNF

Show »
Length:1,303
Mass (Da):145,563
Checksum:i8184E3D50BECA157
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q2P5E9Q2P5_MOUSE
Serine/threonine-protein kinase ULK...
Ulk4
1,275Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QKJ7E9QKJ7_MOUSE
Serine/threonine-protein kinase ULK...
Ulk4
1,188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q220E9Q220_MOUSE
Serine/threonine-protein kinase ULK...
Ulk4
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BX20H7BX20_MOUSE
Serine/threonine-protein kinase ULK...
Ulk4
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0206051 – 1050Missing in isoform 5. 1 PublicationAdd BLAST1050
Alternative sequenceiVSP_0206061 – 430Missing in isoform 4. 1 PublicationAdd BLAST430
Alternative sequenceiVSP_020607527 – 530RSKV → LLYV in isoform 2. 1 Publication4
Alternative sequenceiVSP_020608531 – 1303Missing in isoform 2. 1 PublicationAdd BLAST773
Alternative sequenceiVSP_020609775 – 835LVMYI…RKHPS → RHSQRPGKRVRPEAPIHGPG EAAEDVSPHDACGASSGDVA GISTSSCDRRVSLQLRNYSC E in isoform 4. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_020610836 – 1303Missing in isoform 4. 1 PublicationAdd BLAST468
Alternative sequenceiVSP_020611879 – 910SHIKS…VTLSA → VSSRSHVWPAPLPWLQHGCE KGGIERLSGICL in isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_020612911 – 1303Missing in isoform 3. 2 PublicationsAdd BLAST393
Alternative sequenceiVSP_0206131165 – 1185LPSED…SILVQ → VRAHLCASAEVQRLKQFYLN F in isoform 6. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK016524 mRNA Translation: BAB30285.1
AK043477 mRNA Translation: BAC31554.1
AK043628 mRNA Translation: BAC31600.1
AK132731 mRNA Translation: BAE21324.1
BC109364 mRNA Translation: AAI09365.1
BC109365 mRNA Translation: AAI09366.1

NCBI Reference Sequences

More...
RefSeqi
NP_808257.2, NM_177589.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000171061; ENSMUSP00000129214; ENSMUSG00000040936 [Q3V129-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
209012

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:209012

UCSC genome browser

More...
UCSCi
uc009scz.2, mouse [Q3V129-3]
uc012hcp.1, mouse [Q3V129-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK016524 mRNA Translation: BAB30285.1
AK043477 mRNA Translation: BAC31554.1
AK043628 mRNA Translation: BAC31600.1
AK132731 mRNA Translation: BAE21324.1
BC109364 mRNA Translation: AAI09365.1
BC109365 mRNA Translation: AAI09366.1
RefSeqiNP_808257.2, NM_177589.3

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131342

PTM databases

PhosphoSitePlusiQ3V129

Proteomic databases

PaxDbiQ3V129
PRIDEiQ3V129

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
6576, 98 antibodies

Genome annotation databases

EnsembliENSMUST00000171061; ENSMUSP00000129214; ENSMUSG00000040936 [Q3V129-3]
GeneIDi209012
KEGGimmu:209012
UCSCiuc009scz.2, mouse [Q3V129-3]
uc012hcp.1, mouse [Q3V129-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54986
MGIiMGI:1921622, Ulk4

Phylogenomic databases

eggNOGiKOG0597, Eukaryota
GeneTreeiENSGT00940000156541
HOGENOMiCLU_002110_0_0_1
InParanoidiQ3V129
KOiK17545
OrthoDBi219167at2759
PhylomeDBiQ3V129

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
209012, 1 hit in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ulk4, mouse

Protein Ontology

More...
PROi
PR:Q3V129
RNActiQ3V129, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000040936, Expressed in spermatid and 123 other tissues
ExpressionAtlasiQ3V129, baseline and differential
GenevisibleiQ3V129, MM

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989, ARM-like
IPR016024, ARM-type_fold
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
PfamiView protein in Pfam
PF00069, Pkinase, 1 hit
SUPFAMiSSF48371, SSF48371, 1 hit
SSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011, PROTEIN_KINASE_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiULK4_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3V129
Secondary accession number(s): Q2VP87
, Q32LZ6, Q8BLS0, Q8C8Z5, Q9D4H6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 19, 2006
Last modified: August 12, 2020
This is version 112 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again