Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM198A

Gene

Fam198a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM198A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fam198a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:3041196 Fam198a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 29Sequence analysisAdd BLAST29
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000030194930 – 562Protein FAM198AAdd BLAST533

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3UY90

PRoteomics IDEntifications database

More...
PRIDEi
Q3UY90

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3UY90

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000038233 Expressed in 23 organ(s), highest expression level in nasal concha cartilage

CleanEx database of gene expression profiles

More...
CleanExi
MM_C730027P07RIK

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3UY90 baseline and differential

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q3UY90

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM198 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEN8 Eukaryota
ENOG41103BS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00420000029769

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168840

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107591

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3UY90

Identification of Orthologs from Complete Genome Data

More...
OMAi
PPWLTEH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04A0

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3UY90

TreeFam database of animal gene trees

More...
TreeFami
TF330994

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029207 FAM198

The PANTHER Classification System

More...
PANTHERi
PTHR15905 PTHR15905, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15051 FAM198, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3UY90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSWIWRRLR GKKRSVMAFC LLMVLSAVAV IHFPPGHPAS TPGLNPMEPR
60 70 80 90 100
GEVGASDPRI QQTLNSSLRQ PARNLGHWTG QALPRNPILV CAKKQSRRRQ
110 120 130 140 150
VDRSRHPLSV RRDAILSAQD RELLLEGEVR DAGGAALGQP GHNGLVQETQ
160 170 180 190 200
SKTVTMVVPL TERSHESFQA QRDTAAASFR PWPADGRDPL PGAKNGVLTG
210 220 230 240 250
GKAGSATSGS EAPWWSSSAE DLQKSPWCGT ETPGLAGTAA WGQVPPWFME
260 270 280 290 300
HDAQTLRLLV HGKVVGKARV PAHGQVLQVG LSAGDALQDI SPLRLSQFCS
310 320 330 340 350
QGLCGLIKRS KDLHEVLSFH LDRVLGLQRS LPAVARSFHS PLLPYRYTDG
360 370 380 390 400
SVRPIIWWAP DVQHLRDPDE DQNSLALGWL QYQALLARGC KWPGQIPCLG
410 420 430 440 450
IHHAEWARLA LFDFLLQVHD RLDRYCCGFE PEPSDPCVEE GLREKCRNPE
460 470 480 490 500
ELRLVHILVR SSDPSRLVYI DNAGNLQHPE DKLNFRLLEG IDGFPESAVK
510 520 530 540 550
VLASGCLQNL LFKSLQMDQV FWESQGGAAG LKHVLETLES RGQILLRHIK
560
KHNLTLFRDK DP
Length:562
Mass (Da):62,298
Last modified:October 11, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF2A9D5F81F8E4A7E
GO
Isoform 2 (identifier: Q3UY90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:546
Mass (Da):60,258
Checksum:iCEDF0CC0020FF2C5
GO
Isoform 3 (identifier: Q3UY90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     494-562: FPESAVKVLA...NLTLFRDKDP → IYHVCEGDYGSQKRTADSLELELLEWLCATAYRC

Note: No experimental confirmation available.
Show »
Length:527
Mass (Da):58,447
Checksum:i07685C9927C0ED4E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1L1SUE4A0A1L1SUE4_MOUSE
Protein FAM198A
Fam198a
511Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti425Y → H in BAE34492 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0278851 – 16Missing in isoform 2. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_027886494 – 562FPESA…RDKDP → IYHVCEGDYGSQKRTADSLE LELLEWLCATAYRC in isoform 3. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK050223 mRNA Translation: BAC34133.1
AK134876 mRNA Translation: BAE22322.1
AK139038 mRNA Translation: BAE23872.1
AK158406 mRNA Translation: BAE34492.1
BC113767 mRNA Translation: AAI13768.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS52969.1 [Q3UY90-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001186856.1, NM_001199927.1 [Q3UY90-3]
NP_808411.1, NM_177743.5 [Q3UY90-2]
XP_006512193.1, XM_006512130.1 [Q3UY90-1]
XP_006512194.1, XM_006512131.2 [Q3UY90-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.71062

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000043011; ENSMUSP00000040221; ENSMUSG00000038233 [Q3UY90-2]
ENSMUST00000213773; ENSMUSP00000151175; ENSMUSG00000038233 [Q3UY90-2]
ENSMUST00000215990; ENSMUSP00000149755; ENSMUSG00000038233 [Q3UY90-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
245050

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:245050

UCSC genome browser

More...
UCSCi
uc009sei.2 mouse [Q3UY90-1]
uc012hcv.1 mouse [Q3UY90-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK050223 mRNA Translation: BAC34133.1
AK134876 mRNA Translation: BAE22322.1
AK139038 mRNA Translation: BAE23872.1
AK158406 mRNA Translation: BAE34492.1
BC113767 mRNA Translation: AAI13768.1
CCDSiCCDS52969.1 [Q3UY90-2]
RefSeqiNP_001186856.1, NM_001199927.1 [Q3UY90-3]
NP_808411.1, NM_177743.5 [Q3UY90-2]
XP_006512193.1, XM_006512130.1 [Q3UY90-1]
XP_006512194.1, XM_006512131.2 [Q3UY90-2]
UniGeneiMm.71062

3D structure databases

ProteinModelPortaliQ3UY90
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSitePlusiQ3UY90

Proteomic databases

PaxDbiQ3UY90
PRIDEiQ3UY90

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000043011; ENSMUSP00000040221; ENSMUSG00000038233 [Q3UY90-2]
ENSMUST00000213773; ENSMUSP00000151175; ENSMUSG00000038233 [Q3UY90-2]
ENSMUST00000215990; ENSMUSP00000149755; ENSMUSG00000038233 [Q3UY90-2]
GeneIDi245050
KEGGimmu:245050
UCSCiuc009sei.2 mouse [Q3UY90-1]
uc012hcv.1 mouse [Q3UY90-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
729085
MGIiMGI:3041196 Fam198a

Phylogenomic databases

eggNOGiENOG410IEN8 Eukaryota
ENOG41103BS LUCA
GeneTreeiENSGT00420000029769
HOGENOMiHOG000168840
HOVERGENiHBG107591
InParanoidiQ3UY90
OMAiPPWLTEH
OrthoDBiEOG091G04A0
PhylomeDBiQ3UY90
TreeFamiTF330994

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q3UY90

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000038233 Expressed in 23 organ(s), highest expression level in nasal concha cartilage
CleanExiMM_C730027P07RIK
ExpressionAtlasiQ3UY90 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR029207 FAM198
PANTHERiPTHR15905 PTHR15905, 1 hit
PfamiView protein in Pfam
PF15051 FAM198, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiF198A_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UY90
Secondary accession number(s): Q3TYS0, Q3UTV8, Q8C7H6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: October 11, 2005
Last modified: November 7, 2018
This is version 77 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again