Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM198A

Gene

Fam198a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM198A
Gene namesi
Name:Fam198a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:3041196 Fam198a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000030194930 – 562Protein FAM198AAdd BLAST533

Proteomic databases

PaxDbiQ3UY90
PRIDEiQ3UY90

PTM databases

PhosphoSitePlusiQ3UY90

Expressioni

Gene expression databases

BgeeiENSMUSG00000038233
CleanExiMM_C730027P07RIK
ExpressionAtlasiQ3UY90 baseline and differential

Structurei

3D structure databases

ProteinModelPortaliQ3UY90
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM198 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IEN8 Eukaryota
ENOG41103BS LUCA
GeneTreeiENSGT00420000029769
HOGENOMiHOG000168840
HOVERGENiHBG107591
InParanoidiQ3UY90
OMAiCAEEQGH
OrthoDBiEOG091G04A0
PhylomeDBiQ3UY90
TreeFamiTF330994

Family and domain databases

InterProiView protein in InterPro
IPR029207 FAM198
PANTHERiPTHR15905 PTHR15905, 1 hit
PfamiView protein in Pfam
PF15051 FAM198, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q3UY90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWIWRRLR GKKRSVMAFC LLMVLSAVAV IHFPPGHPAS TPGLNPMEPR
60 70 80 90 100
GEVGASDPRI QQTLNSSLRQ PARNLGHWTG QALPRNPILV CAKKQSRRRQ
110 120 130 140 150
VDRSRHPLSV RRDAILSAQD RELLLEGEVR DAGGAALGQP GHNGLVQETQ
160 170 180 190 200
SKTVTMVVPL TERSHESFQA QRDTAAASFR PWPADGRDPL PGAKNGVLTG
210 220 230 240 250
GKAGSATSGS EAPWWSSSAE DLQKSPWCGT ETPGLAGTAA WGQVPPWFME
260 270 280 290 300
HDAQTLRLLV HGKVVGKARV PAHGQVLQVG LSAGDALQDI SPLRLSQFCS
310 320 330 340 350
QGLCGLIKRS KDLHEVLSFH LDRVLGLQRS LPAVARSFHS PLLPYRYTDG
360 370 380 390 400
SVRPIIWWAP DVQHLRDPDE DQNSLALGWL QYQALLARGC KWPGQIPCLG
410 420 430 440 450
IHHAEWARLA LFDFLLQVHD RLDRYCCGFE PEPSDPCVEE GLREKCRNPE
460 470 480 490 500
ELRLVHILVR SSDPSRLVYI DNAGNLQHPE DKLNFRLLEG IDGFPESAVK
510 520 530 540 550
VLASGCLQNL LFKSLQMDQV FWESQGGAAG LKHVLETLES RGQILLRHIK
560
KHNLTLFRDK DP
Length:562
Mass (Da):62,298
Last modified:October 11, 2005 - v1
Checksum:iF2A9D5F81F8E4A7E
GO
Isoform 2 (identifier: Q3UY90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:546
Mass (Da):60,258
Checksum:iCEDF0CC0020FF2C5
GO
Isoform 3 (identifier: Q3UY90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     494-562: FPESAVKVLA...NLTLFRDKDP → IYHVCEGDYGSQKRTADSLELELLEWLCATAYRC

Note: No experimental confirmation available.
Show »
Length:527
Mass (Da):58,447
Checksum:i07685C9927C0ED4E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti425Y → H in BAE34492 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0278851 – 16Missing in isoform 2. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_027886494 – 562FPESA…RDKDP → IYHVCEGDYGSQKRTADSLE LELLEWLCATAYRC in isoform 3. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK050223 mRNA Translation: BAC34133.1
AK134876 mRNA Translation: BAE22322.1
AK139038 mRNA Translation: BAE23872.1
AK158406 mRNA Translation: BAE34492.1
BC113767 mRNA Translation: AAI13768.1
CCDSiCCDS52969.1 [Q3UY90-2]
RefSeqiNP_001186856.1, NM_001199927.1 [Q3UY90-3]
NP_808411.1, NM_177743.5 [Q3UY90-2]
XP_006512193.1, XM_006512130.1 [Q3UY90-1]
XP_006512194.1, XM_006512131.2 [Q3UY90-2]
UniGeneiMm.71062

Genome annotation databases

EnsembliENSMUST00000043011; ENSMUSP00000040221; ENSMUSG00000038233 [Q3UY90-2]
ENSMUST00000213773; ENSMUSP00000151175; ENSMUSG00000038233 [Q3UY90-2]
ENSMUST00000215990; ENSMUSP00000149755; ENSMUSG00000038233 [Q3UY90-2]
GeneIDi245050
KEGGimmu:245050
UCSCiuc009sei.2 mouse [Q3UY90-1]
uc012hcv.1 mouse [Q3UY90-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiF198A_MOUSE
AccessioniPrimary (citable) accession number: Q3UY90
Secondary accession number(s): Q3TYS0, Q3UTV8, Q8C7H6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: October 11, 2005
Last modified: November 22, 2017
This is version 75 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health