Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (08 May 2019)
Sequence version 2 (22 Jul 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sorbin and SH3 domain-containing protein 2

Gene

Sorbs2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein that plays a role in the assembling of signaling complexes, being a link between ABL kinases and actin cytoskeleton. Can form complex with ABL1 and CBL, thus promoting ubiquitination and degradation of ABL1 (By similarity). May play a role in the regulation of pancreatic cell adhesion, possibly by acting on WASF1 phosphorylation, enhancing phosphorylation by ABL1, as well as dephosphorylation by PTPN12 (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorbin and SH3 domain-containing protein 2
Alternative name(s):
Arg-binding protein 2
Short name:
ArgBP2
Arg/Abl-interacting protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sorbs2
Synonyms:Argbp2, Kiaa0777
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1924574 Sorbs2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003444781 – 1180Sorbin and SH3 domain-containing protein 2Add BLAST1180

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27PhosphoserineCombined sources1
Modified residuei28PhosphoserineCombined sources1
Modified residuei40PhosphoserineBy similarity1
Modified residuei130PhosphoserineCombined sources1
Modified residuei143PhosphoserineCombined sources1
Modified residuei239PhosphoserineCombined sources1
Modified residuei319PhosphoserineCombined sources1
Modified residuei325PhosphoserineCombined sources1
Modified residuei328PhosphoserineCombined sources1
Modified residuei339PhosphoserineCombined sources1
Modified residuei357PhosphothreonineBy similarity1
Modified residuei367PhosphoserineBy similarity1
Modified residuei372PhosphothreonineBy similarity1
Modified residuei377PhosphoserineCombined sources1
Modified residuei378PhosphoserineCombined sources1
Modified residuei379PhosphoserineCombined sources1
Modified residuei381PhosphoserineCombined sources1
Modified residuei382PhosphoserineCombined sources1
Modified residuei384PhosphoserineBy similarity1
Modified residuei463PhosphoserineCombined sources1
Modified residuei574PhosphoserineBy similarity1
Modified residuei577PhosphoserineCombined sources1
Modified residuei630PhosphoserineCombined sources1
Modified residuei633PhosphoserineCombined sources1
Modified residuei829PhosphoserineCombined sources1
Modified residuei923PhosphoserineCombined sources1
Modified residuei1097PhosphoserineCombined sources1
Isoform 5 (identifier: Q3UTJ2-5)
Modified residuei322PhosphoserineCombined sources1
Modified residuei324PhosphoserineCombined sources1
Modified residuei330PhosphoserineCombined sources1
Modified residuei332PhosphoserineCombined sources1
Isoform 2 (identifier: Q3UTJ2-2)
Modified residuei345PhosphoserineCombined sources1
Modified residuei347PhosphoserineCombined sources1
Modified residuei353PhosphoserineCombined sources1
Modified residuei355PhosphoserineCombined sources1
Modified residuei368PhosphoserineCombined sources1
Modified residuei373PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by CBL.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3UTJ2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3UTJ2

PeptideAtlas

More...
PeptideAtlasi
Q3UTJ2

PRoteomics IDEntifications database

More...
PRIDEi
Q3UTJ2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3UTJ2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3UTJ2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000031626 Expressed in 252 organ(s), highest expression level in cardiac ventricle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3UTJ2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3UTJ2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ABL, CBL, DNM1, DNM2, FLOT1, AFDN, PTK2B/PYK2, SAPAP, SPTAN1, SYNJ1, SYNJ2, VCL/vinculin, WASF, ABL1/c-Abl, ABL2/v-Abl/Arg, ACTN, CBL and PALLD.

Interacts with PTPN12 and WASF1 via its SH3 domains; this interaction may mediate the partial PTPN12 and WASF1 translocation to focal adhesion sites.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
231503, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q3UTJ2, 12 interactors

Molecular INTeraction database

More...
MINTi
Q3UTJ2

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000121619

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3UTJ2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini166 – 230SoHoPROSITE-ProRule annotationAdd BLAST65
Domaini943 – 1002SH3 1PROSITE-ProRule annotationAdd BLAST60
Domaini1018 – 1079SH3 2PROSITE-ProRule annotationAdd BLAST62
Domaini1121 – 1180SH3 3PROSITE-ProRule annotationAdd BLAST60

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi720 – 731His-richAdd BLAST12
Compositional biasi1011 – 1014Poly-Pro4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The first 2 SH3 domains are required for WASF1-binding. All 3 SH3 domains can bind independently to PTPN12.By similarity

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410KCZT Eukaryota
ENOG410XNVJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157056

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3UTJ2

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR013087 Znf_C2H2_type

The PANTHER Classification System

More...
PANTHERi
PTHR14167:SF56 PTHR14167:SF56, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 22 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3UTJ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNTDSGGCAR KRAAMSVTLT SVKRVQSSPN LLAAGRESQS PDSAWRSYND
60 70 80 90 100
RNPETLNGDA TYSSLAAKGF RSVRPNLQDK RSPTQSQITI NGNSGGAVSP
110 120 130 140 150
VSYYQRPFSP SAYSLPASLN SSIIMQHGRS LDSAETYSQH AQSLDGTMGS
160 170 180 190 200
SIPLYRSSEE EKRVTVIKAP HYPGIGPVDE SGIPTAIRTT VDRPKDWYKT
210 220 230 240 250
MFKQIHMVHK PGLYNSPYSA QSHPAAKTQT YRPLSKSHSD NGTDAFKEVP
260 270 280 290 300
SPVPPPHVPP RPRDQSSTLK HDWDPPDRKV DTRKFRSEPR SIFEYEPGKS
310 320 330 340 350
SILQHERPVS IYQSSIDRSL ERPSSSASMA GDFRKRRKSE PAVGPLRGLG
360 370 380 390 400
DQSSSRTSPG RADLPGSSST FTKSFISSSP SSPSRAQGGD DSKMCPPLCS
410 420 430 440 450
YSGLNGTPSG ELECCNAYRQ HLDVPGDSQR AITFKNGWQM ARQNAEIWSS
460 470 480 490 500
TEETVSPKIK SRSCDDLLND DCDSFPDPKT KSESMGSLLC EEDSKESCPM
510 520 530 540 550
TWASPYIQEV CGNSRSRLKH RSAHNAPGFL KMYKKMHRIN RKDLMNSEVI
560 570 580 590 600
CSVKSRILQY EKEQQHRGLL HGWSQSSTEE VPRDVVPTRI SEFEKLIQKS
610 620 630 640 650
KSMPNLGDEM LSPITLEPPQ NGLCPKRRFS IESLLEEETQ VRHPSQGQRS
660 670 680 690 700
CKSNTLVPIH IEVTSDEQPR THMEFSDSDQ DGVVSDHSDY VHVEGSSFCS
710 720 730 740 750
ESDFDHFSFT SSESFYGSSH HHHHHHHHHR HLISSCKGRC PASYTRFTTM
760 770 780 790 800
LKHERAKHEN MDRPRRQEMD PGLSKLAFLV SPVPFRRKKI LTPQKQTEKA
810 820 830 840 850
KCKASVVEAL DSALKDICDQ IKAEKRRGSL PDNSILHRLI SELLPQIPER
860 870 880 890 900
NSSLHALKRS PMHQPFHPLP PDGASHCPLY QNDCGRMPHS ASFPDVDTTS
910 920 930 940 950
NYHAQDYGSA LSLQDHESPR SYSSTLTDLG RSASRERRGT PEKEKLPAKA
960 970 980 990 1000
VYDFKAQTSK ELSFKKGDTV YILRKIDQNW YEGEHHGRVG IFPISYVEKL
1010 1020 1030 1040 1050
TPPEKAQPAR PPPPVQPGEI GEAIAKYNFN ADTNVELSLR KGDRIILLKR
1060 1070 1080 1090 1100
VDQNWYEGKI PGTNRQGIFP VSYVEVVKRN AKGAEDYPDP PLPHSYSSDR
1110 1120 1130 1140 1150
IYTLSSNKPQ RPGFSHENIQ GGGEPFQALY NYTPRNEDEL ELRESDVVDV
1160 1170 1180
MEKCDDGWFV GTSRRTKFFG TFPGNYVKRL
Note: No experimental confirmation available.
Length:1,180
Mass (Da):132,349
Last modified:July 22, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i99ECA798E95A092E
GO
Isoform 2 (identifier: Q3UTJ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     211-211: P → PDEDTDMYNTPYTYNA
     308-308: P → PPPLPPTPTP...QDHSSGVSNE

Note: No experimental confirmation available.Combined sources
Show »
Length:1,295
Mass (Da):145,012
Checksum:i05E03BF51F0D0FE4
GO
Isoform 3 (identifier: Q3UTJ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     4-34: Missing.
     211-211: P → PDEDTDMYNTPYTYNA
     388-914: Missing.
     1126-1180: FQALYNYTPRNEDELELRESDVVDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL → LQ

Note: No experimental confirmation available.
Show »
Length:584
Mass (Da):64,990
Checksum:i2E93E14021A5F1AE
GO
Isoform 4 (identifier: Q3UTJ2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     4-34: Missing.
     388-914: Missing.

Note: No experimental confirmation available.
Show »
Length:622
Mass (Da):69,477
Checksum:i63298ED47475B3F1
GO
Isoform 5 (identifier: Q3UTJ2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-67: Missing.
     211-211: P → PDEDTDMYNTPYTYNA
     308-308: P → PPPLPPTPTPVPREPSRKPLSVSPSTDGLRSPSPPPRSCVPAPCPSAPDLSPTRPPKKALDYVQDHSSGVSNE
     388-914: Missing.
     1126-1135: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:707
Mass (Da):78,102
Checksum:i726FB101E2D1A269
GO
Isoform 6 (identifier: Q3UTJ2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-67: Missing.
     211-211: P → PDEDTDMYNTPYTYNA
     309-316: VSIYQSSI → RSVSSRPL
     317-1180: Missing.

Note: No experimental confirmation available.
Show »
Length:308
Mass (Da):34,144
Checksum:iEFC3C49B080C2BDB
GO
Isoform 7 (identifier: Q3UTJ2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-313: IYQ → PCH
     314-1180: Missing.

Note: No experimental confirmation available.
Show »
Length:313
Mass (Da):34,573
Checksum:i403BEF28C731B333
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 22 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B9EKP8B9EKP8_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
1,214Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZWM6B7ZWM6_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
1,196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Z4YJR7Z4YJR7_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
1,079Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J1T1A0A0R4J1T1_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
1,134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z080D3Z080_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
707Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B2RXQ9B2RXQ9_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
652Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J1W0A0A0R4J1W0_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
623Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z203D3Z203_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZWT0F6ZWT0_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J1X5A0A0R4J1X5_MOUSE
Sorbin and SH3 domain-containing pr...
Sorbs2
532Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti249V → A in AAH39163 (PubMed:15489334).Curated1
Sequence conflicti944E → EV in BAE24407 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0348004 – 34Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_03480145 – 67Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST23
Alternative sequenceiVSP_034802211P → PDEDTDMYNTPYTYNA in isoform 2, isoform 3, isoform 5 and isoform 6. 3 Publications1
Alternative sequenceiVSP_034803308P → PPPLPPTPTPVPREPSRKPL SVSPSTDGLRSPSPPPRSCV PAPRPSAPDLSPTRTGRINP ADIDLENEPWYKFFSELEFG HPPPKKALDYVQDHSSGVSN E in isoform 2. 1 Publication1
Alternative sequenceiVSP_034804308P → PPPLPPTPTPVPREPSRKPL SVSPSTDGLRSPSPPPRSCV PAPCPSAPDLSPTRPPKKAL DYVQDHSSGVSNE in isoform 5. 2 Publications1
Alternative sequenceiVSP_034805309 – 316VSIYQSSI → RSVSSRPL in isoform 6. 1 Publication8
Alternative sequenceiVSP_034806311 – 313IYQ → PCH in isoform 7. 1 Publication3
Alternative sequenceiVSP_034807314 – 1180Missing in isoform 7. 1 PublicationAdd BLAST867
Alternative sequenceiVSP_034808317 – 1180Missing in isoform 6. 1 PublicationAdd BLAST864
Alternative sequenceiVSP_034809388 – 914Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST527
Alternative sequenceiVSP_0348101126 – 1180FQALY…YVKRL → LQ in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0348111126 – 1135Missing in isoform 5. 2 Publications10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK041051 mRNA Translation: BAC30799.1
AK049030 mRNA Translation: BAC33518.1
AK079130 mRNA Translation: BAC37554.1
AK083429 mRNA Translation: BAC38913.1
AK139388 mRNA Translation: BAE23988.1
AK140498 mRNA Translation: BAE24407.1
BC039163 mRNA Translation: AAH39163.1
AK122369 mRNA Translation: BAC65651.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS80872.1 [Q3UTJ2-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001297636.1, NM_001310707.1
XP_006509449.1, XM_006509386.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000134675; ENSMUSP00000118160; ENSMUSG00000031626 [Q3UTJ2-6]
ENSMUST00000141039; ENSMUSP00000117544; ENSMUSG00000031626 [Q3UTJ2-6]
ENSMUST00000153798; ENSMUSP00000118353; ENSMUSG00000031626 [Q3UTJ2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
234214

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:234214

UCSC genome browser

More...
UCSCi
uc009lpb.2 mouse [Q3UTJ2-6]
uc009lpc.2 mouse [Q3UTJ2-1]
uc009lpf.1 mouse [Q3UTJ2-3]
uc009lpi.2 mouse [Q3UTJ2-4]
uc029wsw.1 mouse [Q3UTJ2-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041051 mRNA Translation: BAC30799.1
AK049030 mRNA Translation: BAC33518.1
AK079130 mRNA Translation: BAC37554.1
AK083429 mRNA Translation: BAC38913.1
AK139388 mRNA Translation: BAE23988.1
AK140498 mRNA Translation: BAE24407.1
BC039163 mRNA Translation: AAH39163.1
AK122369 mRNA Translation: BAC65651.1
CCDSiCCDS80872.1 [Q3UTJ2-5]
RefSeqiNP_001297636.1, NM_001310707.1
XP_006509449.1, XM_006509386.1

3D structure databases

SMRiQ3UTJ2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi231503, 15 interactors
IntActiQ3UTJ2, 12 interactors
MINTiQ3UTJ2
STRINGi10090.ENSMUSP00000121619

PTM databases

iPTMnetiQ3UTJ2
PhosphoSitePlusiQ3UTJ2

Proteomic databases

jPOSTiQ3UTJ2
PaxDbiQ3UTJ2
PeptideAtlasiQ3UTJ2
PRIDEiQ3UTJ2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000134675; ENSMUSP00000118160; ENSMUSG00000031626 [Q3UTJ2-6]
ENSMUST00000141039; ENSMUSP00000117544; ENSMUSG00000031626 [Q3UTJ2-6]
ENSMUST00000153798; ENSMUSP00000118353; ENSMUSG00000031626 [Q3UTJ2-3]
GeneIDi234214
KEGGimmu:234214
UCSCiuc009lpb.2 mouse [Q3UTJ2-6]
uc009lpc.2 mouse [Q3UTJ2-1]
uc009lpf.1 mouse [Q3UTJ2-3]
uc009lpi.2 mouse [Q3UTJ2-4]
uc029wsw.1 mouse [Q3UTJ2-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8470
MGIiMGI:1924574 Sorbs2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410KCZT Eukaryota
ENOG410XNVJ LUCA
GeneTreeiENSGT00940000157056
InParanoidiQ3UTJ2

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q3UTJ2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000031626 Expressed in 252 organ(s), highest expression level in cardiac ventricle
ExpressionAtlasiQ3UTJ2 baseline and differential
GenevisibleiQ3UTJ2 MM

Family and domain databases

InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR013087 Znf_C2H2_type
PANTHERiPTHR14167:SF56 PTHR14167:SF56, 2 hits
PfamiView protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit
SUPFAMiSSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRBS2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UTJ2
Secondary accession number(s): Q3USC6
, Q80TS1, Q8BJL6, Q8BJU3, Q8BLW9, Q8BX47, Q8CHU0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: May 8, 2019
This is version 110 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again