Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcolemmal membrane-associated protein

Gene

Slmap

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role during myoblast fusion.1 Publication

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcolemmal membrane-associated protein
Short name:
Sarcolemmal-associated protein
Gene namesi
Name:Slmap
Synonyms:Kiaa1601, Slap
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:1933549 Slmap

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 819CytoplasmicSequence analysisAdd BLAST819
Transmembranei820 – 840Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini841 – 845ExtracellularSequence analysis5

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002596631 – 845Sarcolemmal membrane-associated proteinAdd BLAST845

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei148PhosphoserineBy similarity1
Modified residuei465PhosphoserineBy similarity1
Modified residuei469PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ3URD3
PaxDbiQ3URD3
PeptideAtlasiQ3URD3
PRIDEiQ3URD3

PTM databases

iPTMnetiQ3URD3
PhosphoSitePlusiQ3URD3

Expressioni

Tissue specificityi

Expressed in proliferating myoblasts and differentiated myotubes (at protein level). Expressed in myoblasts, cardiac and skeletal muscles.2 Publications

Developmental stagei

Expressed in atrial and ventricular chambers of the primitive heart at 9 dpc. Expressed in somites at 11 dpc. Expressed in atrial and ventricular chambers and interventricular and interatrial septum at 13 dpc. Expressed in myotubes between 13 and 15 dpc. Expressed in skeletal muscles at 18 dpc.1 Publication

Gene expression databases

BgeeiENSMUSG00000021870 Expressed in 295 organ(s), highest expression level in aorta
CleanExiMM_SLMAP
ExpressionAtlasiQ3URD3 baseline and differential
GenevisibleiQ3URD3 MM

Interactioni

Subunit structurei

Homodimer. Interacts with myosin.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Wasf2Q8BH433EBI-3294998,EBI-643162

GO - Molecular functioni

Protein-protein interaction databases

BioGridi219996, 2 interactors
IntActiQ3URD3, 3 interactors
STRINGi10090.ENSMUSP00000046956

Structurei

3D structure databases

ProteinModelPortaliQ3URD3
SMRiQ3URD3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini28 – 85FHAPROSITE-ProRule annotationAdd BLAST58

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 163Necessary for targeting to centrosomesAdd BLAST163

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili167 – 202Sequence analysisAdd BLAST36
Coiled coili231 – 388Sequence analysisAdd BLAST158
Coiled coili506 – 816Sequence analysisAdd BLAST311

Sequence similaritiesi

Belongs to the SLMAP family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3872 Eukaryota
COG1716 LUCA
GeneTreeiENSGT00530000063197
HOGENOMiHOG000072709
HOVERGENiHBG082442
InParanoidiQ3URD3
OrthoDBiEOG091G081W
PhylomeDBiQ3URD3
TreeFamiTF318787

Family and domain databases

CDDicd00060 FHA, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR001363 Prot_inh_fetuin_CS
IPR030498 SLMAP
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR15715:SF22 PTHR15715:SF22, 1 hit
PfamiView protein in Pfam
PF00498 FHA, 1 hit
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3URD3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSALAIFTC RPNSHPFQER HVYLDEPIKI GRSVARCRPA QNNATFDCKV
60 70 80 90 100
LSRNHALVWF DHKTSKFYLQ DTKSSNGTFI NSQRLSRGSE ESPPCEILSG
110 120 130 140 150
DIIQFGVDVT ENTRKVTHGC IVSTIKLFLP DGMEARLRSD VIHAPLPSPV
160 170 180 190 200
DKVAANTPSM YSQELFQLSQ YLQEALHREQ MLEQKLATLQ RLLAITQEAS
210 220 230 240 250
DTSWQALIDE DRLLSRLEVM GNQLQACSKN QTEDSLRKEL IALQEDKHSY
260 270 280 290 300
ETTAKESLRR VLQEKIEVVR KLSEVERSLS NTEDECTHLK EMNERTQEEL
310 320 330 340 350
RELANKYNGA VNEIKDLSDK LKVAEGKQEE IQQKGQAEKK ELQTKIDEME
360 370 380 390 400
EKEQELQAKI EALQADNDFT NERLTALQVR LEHLQEKTLK ECSSLGIQVD
410 420 430 440 450
DFLPKINGST EKEHLLSKSG GDCTFIHQFL ECQKKLMVQG HLTKVVEESK
460 470 480 490 500
LSKENQAKAK ESDLSDTLSP SKEKSSDDTT DAQMDEQDLN EPLAKVSLLK
510 520 530 540 550
DDLQGTQSET EAKQDIQHLR KELVEAQELA RTSKQKCFEL QALLEEERKA
560 570 580 590 600
YRNQVEESAK QIQVLQVQLQ KLHMDMENLQ EEKDTEISST RDKLLSAQDE
610 620 630 640 650
ILLLRQAAAE AVSERDTDFV SLQEELKKVR AELEGWRKAA SEYENEIRSL
660 670 680 690 700
QSSFQLRCQQ CEDQQREEAT RLQGELEKLK KEWDVLETEC HSLKKENVLL
710 720 730 740 750
SSELQRQEKE LHNSQKQSFE LTSDLSILQM TRKELEKQVG SLKEQHLRDA
760 770 780 790 800
ADLKTLLSKA ENQAKDVQKE YEKTQTVLSE LKLKFEMTEQ EKQSITDELK
810 820 830 840
QCKDNLKLLR EKGNNKPWPW MPMLAALVAV TAMVLYVPGL ARASP
Length:845
Mass (Da):96,933
Last modified:October 31, 2006 - v2
Checksum:iFC73049C382CA17F
GO
Isoform 2 (identifier: Q3URD3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     414-434: Missing.
     816-845: KPWPWMPMLAALVAVTAMVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW

Show »
Length:821
Mass (Da):94,401
Checksum:iA1AFD5A6A76DECE9
GO
Isoform 3 (identifier: Q3URD3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-483: Missing.

Show »
Length:362
Mass (Da):42,023
Checksum:i70CC7CE5E8A653F7
GO
Isoform 4 (identifier: Q3URD3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-483: Missing.
     816-845: KPWPWMPMLAALVAVTAMVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW

Show »
Length:359
Mass (Da):41,864
Checksum:iE7FF9AA7C01977E5
GO
Isoform 5 (identifier: Q3URD3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-348: Missing.
     396-434: GIQVDDFLPKINGSTEKEHLLSKSGGDCTFIHQFLECQK → E

Show »
Length:459
Mass (Da):52,981
Checksum:iFD07C79F8EBC053F
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z7V3D3Z7V3_MOUSE
Sarcolemmal membrane-associated pro...
Slmap
790Annotation score:
H7BX64H7BX64_MOUSE
Sarcolemmal membrane-associated pro...
Slmap
828Annotation score:
F8WIH0F8WIH0_MOUSE
Sarcolemmal membrane-associated pro...
Slmap
690Annotation score:
F6UV57F6UV57_MOUSE
Sarcolemmal membrane-associated pro...
Slmap
433Annotation score:
F6YCM8F6YCM8_MOUSE
Sarcolemmal membrane-associated pro...
Slmap
477Annotation score:
F6WY34F6WY34_MOUSE
Sarcolemmal membrane-associated pro...
Slmap
184Annotation score:

Sequence cautioni

The sequence BAC98213 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAE24755 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti682E → G in AAG41950 (PubMed:10986292).Curated1
Sequence conflicti696 – 697EN → GD in AAG41950 (PubMed:10986292).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0215141 – 483Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST483
Alternative sequenceiVSP_0215151 – 348Missing in isoform 5. 1 PublicationAdd BLAST348
Alternative sequenceiVSP_021516396 – 434GIQVD…LECQK → E in isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_021517414 – 434Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_021518816 – 845KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 2 and isoform 4. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF304451 mRNA Translation: AAG41950.1
AK129403 mRNA Translation: BAC98213.1 Different initiation.
AK141597 mRNA Translation: BAE24755.1 Different initiation.
AK146685 mRNA Translation: BAE27359.1
AK164911 mRNA Translation: BAE37961.1
AK166396 mRNA Translation: BAE38752.1
BC021457 mRNA Translation: AAH21457.1
CCDSiCCDS26880.1 [Q3URD3-2]
CCDS79284.1 [Q3URD3-1]
RefSeqiNP_001297374.1, NM_001310445.1 [Q3URD3-1]
NP_001334423.1, NM_001347494.1
NP_114397.3, NM_032008.4 [Q3URD3-2]
XP_017171716.1, XM_017316227.1 [Q3URD3-1]
XP_017171717.1, XM_017316228.1 [Q3URD3-2]
UniGeneiMm.36769

Genome annotation databases

EnsembliENSMUST00000038522; ENSMUSP00000046956; ENSMUSG00000021870 [Q3URD3-2]
ENSMUST00000102956; ENSMUSP00000100021; ENSMUSG00000021870 [Q3URD3-2]
ENSMUST00000139075; ENSMUSP00000117816; ENSMUSG00000021870 [Q3URD3-1]
GeneIDi83997
KEGGimmu:83997
UCSCiuc007ssq.1 mouse [Q3URD3-5]
uc007ssr.1 mouse [Q3URD3-2]
uc007sss.1 mouse [Q3URD3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF304451 mRNA Translation: AAG41950.1
AK129403 mRNA Translation: BAC98213.1 Different initiation.
AK141597 mRNA Translation: BAE24755.1 Different initiation.
AK146685 mRNA Translation: BAE27359.1
AK164911 mRNA Translation: BAE37961.1
AK166396 mRNA Translation: BAE38752.1
BC021457 mRNA Translation: AAH21457.1
CCDSiCCDS26880.1 [Q3URD3-2]
CCDS79284.1 [Q3URD3-1]
RefSeqiNP_001297374.1, NM_001310445.1 [Q3URD3-1]
NP_001334423.1, NM_001347494.1
NP_114397.3, NM_032008.4 [Q3URD3-2]
XP_017171716.1, XM_017316227.1 [Q3URD3-1]
XP_017171717.1, XM_017316228.1 [Q3URD3-2]
UniGeneiMm.36769

3D structure databases

ProteinModelPortaliQ3URD3
SMRiQ3URD3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi219996, 2 interactors
IntActiQ3URD3, 3 interactors
STRINGi10090.ENSMUSP00000046956

PTM databases

iPTMnetiQ3URD3
PhosphoSitePlusiQ3URD3

Proteomic databases

MaxQBiQ3URD3
PaxDbiQ3URD3
PeptideAtlasiQ3URD3
PRIDEiQ3URD3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000038522; ENSMUSP00000046956; ENSMUSG00000021870 [Q3URD3-2]
ENSMUST00000102956; ENSMUSP00000100021; ENSMUSG00000021870 [Q3URD3-2]
ENSMUST00000139075; ENSMUSP00000117816; ENSMUSG00000021870 [Q3URD3-1]
GeneIDi83997
KEGGimmu:83997
UCSCiuc007ssq.1 mouse [Q3URD3-5]
uc007ssr.1 mouse [Q3URD3-2]
uc007sss.1 mouse [Q3URD3-1]

Organism-specific databases

CTDi7871
MGIiMGI:1933549 Slmap
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3872 Eukaryota
COG1716 LUCA
GeneTreeiENSGT00530000063197
HOGENOMiHOG000072709
HOVERGENiHBG082442
InParanoidiQ3URD3
OrthoDBiEOG091G081W
PhylomeDBiQ3URD3
TreeFamiTF318787

Miscellaneous databases

ChiTaRSiSlmap mouse
PROiPR:Q3URD3
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021870 Expressed in 295 organ(s), highest expression level in aorta
CleanExiMM_SLMAP
ExpressionAtlasiQ3URD3 baseline and differential
GenevisibleiQ3URD3 MM

Family and domain databases

CDDicd00060 FHA, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR001363 Prot_inh_fetuin_CS
IPR030498 SLMAP
IPR008984 SMAD_FHA_dom_sf
PANTHERiPTHR15715:SF22 PTHR15715:SF22, 1 hit
PfamiView protein in Pfam
PF00498 FHA, 1 hit
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSLMAP_MOUSE
AccessioniPrimary (citable) accession number: Q3URD3
Secondary accession number(s): Q3TLP0
, Q3UIZ6, Q6ZPL8, Q8VC86, Q9EQ03
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 7, 2018
This is version 107 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again