Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (16 Oct 2019)
Sequence version 2 (02 Oct 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Acyl-coenzyme A synthetase ACSM3, mitochondrial

Gene

Acsm3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism (PubMed:11470804). Capable of activating medium-chain fatty acids with a preference for isobutyrate among fatty acids with 2-6 carbon atoms (PubMed:11470804).1 Publication

Caution

It is uncertain whether Met-1 or Met-3 is the initiator.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity, Mn2+By similarity

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.92 mM for butyrate1 Publication
  2. KM=0.05 mM for isobutyrate1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei455ATPBy similarity1
    Binding sitei470ATPBy similarity1
    Binding sitei566ATPBy similarity1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi229 – 237ATPBy similarity9
    Nucleotide bindingi368 – 373ATPBy similarity6

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionLigase
    Biological processFatty acid metabolism, Lipid metabolism
    LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...
    SwissLipidsi
    SLP:000001206

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Acyl-coenzyme A synthetase ACSM3, mitochondrial (EC:6.2.1.21 Publication)
    Alternative name(s):
    Acyl-CoA synthetase medium-chain family member 3
    Butyrate--CoA ligase 3
    Butyryl-coenzyme A synthetase 3
    Middle-chain acyl-CoA synthetase 3
    Propionate--CoA ligase (EC:6.2.1.171 Publication)
    Protein SA homolog
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:Acsm3
    Synonyms:Sa, Sah
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

    Organism-specific databases

    Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

    More...
    MGIi
    MGI:99538 Acsm3

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Mitochondrion

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 21MitochondrionSequence analysisAdd BLAST21
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000030609822 – 580Acyl-coenzyme A synthetase ACSM3, mitochondrialAdd BLAST559

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei67N6-succinyllysineCombined sources1
    Modified residuei100N6-succinyllysineCombined sources1
    Modified residuei151N6-acetyllysineCombined sources1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q3UNX5

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q3UNX5

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q3UNX5

    PeptideAtlas

    More...
    PeptideAtlasi
    Q3UNX5

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q3UNX5

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q3UNX5

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q3UNX5

    SwissPalm database of S-palmitoylation events

    More...
    SwissPalmi
    Q3UNX5

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Detected in kidney (at protein level). Detected in kidney proximal tubules and in liver. Detected at low levels in testis, stomach, heart and lung.4 Publications

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Up-regulated in kidney by androgens. Down-regulated in kidney by estrogens. Levels in kidney are very low in female C57BL/6 mice and in castrated male C57BL/6, 129/SvJ and BALB/c mice. Constitutively expressed in liver.2 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSMUSG00000030935 Expressed in 118 organ(s), highest expression level in proximal tubule

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q3UNX5 MM

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    STRING: functional protein association networks

    More...
    STRINGi
    10090.ENSMUSP00000068803

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q3UNX5

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1175 Eukaryota
    COG0365 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000157930

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000229982

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q3UNX5

    KEGG Orthology (KO)

    More...
    KOi
    K01896

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    HAWSNLF

    Database of Orthologous Groups

    More...
    OrthoDBi
    683933at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q3UNX5

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF354287

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    3.40.50.12780, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR025110 AMP-bd_C
    IPR020845 AMP-binding_CS
    IPR000873 AMP-dep_Synth/Lig
    IPR042099 AMP-dep_Synthh-like_sf

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00501 AMP-binding, 1 hit
    PF13193 AMP-binding_C, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS00455 AMP_BINDING, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: Q3UNX5-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MVMLLRARCF QRLAIPDPMR VLYKDYRTAT PQNFSNYESM KQDFKIEIPE
    60 70 80 90 100
    YFNFAKDVLD QWTNMEKAGK RLSNPAFWWI DGNGEELRWS FEELGLLSRK
    110 120 130 140 150
    FANILTEACS LQRGDRVMVI LPKIPEWWLA NVACLRTGTV LIPGTTQLTQ
    160 170 180 190 200
    KDILYRLQSS KAKCIITDDT LAPAVDAVAA KCENLHSKLI VSQHSREGWG
    210 220 230 240 250
    NLKEMMKYAS DSHTCVDTKH DEMMAIYFTS GTTGPPKMIG HTHSSFGLGL
    260 270 280 290 300
    SVNGRFWLDL IASDVMWNTS DTGWAKSAWS SVFSPWTQGA CVFAHYLPRF
    310 320 330 340 350
    ESTSILQTLS KFPITVFCSA PTAYRMLVQN DMSSYKFNSL KHCVSAGEPI
    360 370 380 390 400
    NPEVMEQWRK KTGLDIYEGY GQTETVLICG NFKGMKIKPG SMGKPSPAFD
    410 420 430 440 450
    VKILDENGAT LPPGQEGDIA LQVLPERPFG LFTHYVDNPS KTASTLRGSF
    460 470 480 490 500
    YITGDRGYMD EDGYFWFVAR SDDIILSSGY RIGPFEVESA LIEHPSIAES
    510 520 530 540 550
    AVVSSPDPIR GEVVKAFIVL NPDYKSHDQE QLKKEIQEHV KKTTAPYKYP
    560 570 580
    RKVEFIEELP KTVSGKVKRN ELRKKEWVTT
    Length:580
    Mass (Da):65,623
    Last modified:October 2, 2007 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCAF3D06A0B4A2778
    GO
    Isoform 2 (identifier: Q3UNX5-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         578-580: VTT → EQGLLHEQMTVDRLLGKSARHERHVPSVCMNCSGVAAVLRYAEAA

    Note: No experimental confirmation available.
    Show »
    Length:622
    Mass (Da):70,238
    Checksum:i4F98E4406704D0F2
    GO

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAC79656 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence AAH15248 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence AAL40880 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence BAA37141 differs from that shown. Reason: Frameshift.Curated
    The sequence BAE38232 differs from that shown. Reason: Erroneous initiation.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti137T → P in AAC79656 (PubMed:15525578).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028397578 – 580VTT → EQGLLHEQMTVDRLLGKSAR HERHVPSVCMNCSGVAAVLR YAEAA in isoform 2. 1 Publication3

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AY064696 mRNA Translation: AAL40880.1 Different initiation.
    AB022340 mRNA Translation: BAA37141.1 Frameshift.
    AF068246 mRNA Translation: AAC79656.1 Different initiation.
    AK041060 mRNA Translation: BAC30805.1
    AK143946 mRNA Translation: BAE25622.1
    AK165516 mRNA Translation: BAE38232.1 Different initiation.
    BC015248 mRNA Translation: AAH15248.1 Different initiation.

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS21786.1 [Q3UNX5-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_058566.3, NM_016870.3 [Q3UNX5-1]
    NP_997606.2, NM_212441.2 [Q3UNX5-1]
    NP_997607.2, NM_212442.2 [Q3UNX5-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENSMUST00000063770; ENSMUSP00000068803; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106526; ENSMUSP00000102136; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106527; ENSMUSP00000102137; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106528; ENSMUSP00000102138; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106529; ENSMUSP00000102139; ENSMUSG00000030935 [Q3UNX5-2]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    20216

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    mmu:20216

    UCSC genome browser

    More...
    UCSCi
    uc009jlq.1 mouse [Q3UNX5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AY064696 mRNA Translation: AAL40880.1 Different initiation.
    AB022340 mRNA Translation: BAA37141.1 Frameshift.
    AF068246 mRNA Translation: AAC79656.1 Different initiation.
    AK041060 mRNA Translation: BAC30805.1
    AK143946 mRNA Translation: BAE25622.1
    AK165516 mRNA Translation: BAE38232.1 Different initiation.
    BC015248 mRNA Translation: AAH15248.1 Different initiation.
    CCDSiCCDS21786.1 [Q3UNX5-1]
    RefSeqiNP_058566.3, NM_016870.3 [Q3UNX5-1]
    NP_997606.2, NM_212441.2 [Q3UNX5-1]
    NP_997607.2, NM_212442.2 [Q3UNX5-1]

    3D structure databases

    SMRiQ3UNX5
    ModBaseiSearch...

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000068803

    Chemistry databases

    SwissLipidsiSLP:000001206

    PTM databases

    iPTMnetiQ3UNX5
    PhosphoSitePlusiQ3UNX5
    SwissPalmiQ3UNX5

    Proteomic databases

    jPOSTiQ3UNX5
    MaxQBiQ3UNX5
    PaxDbiQ3UNX5
    PeptideAtlasiQ3UNX5
    PRIDEiQ3UNX5

    Genome annotation databases

    EnsembliENSMUST00000063770; ENSMUSP00000068803; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106526; ENSMUSP00000102136; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106527; ENSMUSP00000102137; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106528; ENSMUSP00000102138; ENSMUSG00000030935 [Q3UNX5-1]
    ENSMUST00000106529; ENSMUSP00000102139; ENSMUSG00000030935 [Q3UNX5-2]
    GeneIDi20216
    KEGGimmu:20216
    UCSCiuc009jlq.1 mouse [Q3UNX5-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    6296
    MGIiMGI:99538 Acsm3

    Phylogenomic databases

    eggNOGiKOG1175 Eukaryota
    COG0365 LUCA
    GeneTreeiENSGT00940000157930
    HOGENOMiHOG000229982
    InParanoidiQ3UNX5
    KOiK01896
    OMAiHAWSNLF
    OrthoDBi683933at2759
    PhylomeDBiQ3UNX5
    TreeFamiTF354287

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    Acsm3 mouse

    Protein Ontology

    More...
    PROi
    PR:Q3UNX5

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSMUSG00000030935 Expressed in 118 organ(s), highest expression level in proximal tubule
    GenevisibleiQ3UNX5 MM

    Family and domain databases

    Gene3Di3.40.50.12780, 1 hit
    InterProiView protein in InterPro
    IPR025110 AMP-bd_C
    IPR020845 AMP-binding_CS
    IPR000873 AMP-dep_Synth/Lig
    IPR042099 AMP-dep_Synthh-like_sf
    PfamiView protein in Pfam
    PF00501 AMP-binding, 1 hit
    PF13193 AMP-binding_C, 1 hit
    PROSITEiView protein in PROSITE
    PS00455 AMP_BINDING, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACSM3_MOUSE
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UNX5
    Secondary accession number(s): Q8BRY2
    , Q91WI1, Q9Z2F3, Q9Z2X0
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
    Last sequence update: October 2, 2007
    Last modified: October 16, 2019
    This is version 110 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again