Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (29 Sep 2021)
Sequence version 2 (02 Oct 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Acyl-coenzyme A synthetase ACSM3, mitochondrial

Gene

Acsm3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism (PubMed:11470804).

Capable of activating medium-chain fatty acids with a preference for isobutyrate among fatty acids with 2-6 carbon atoms (PubMed:11470804).

1 Publication

Caution

It is uncertain whether Met-1 or Met-3 is the initiator.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity, Mn2+By similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.92 mM for butyrate1 Publication
  2. KM=0.05 mM for isobutyrate1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei455ATPBy similarity1
Binding sitei470ATPBy similarity1
Binding sitei566ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi229 – 237ATPBy similarity9
Nucleotide bindingi368 – 373ATPBy similarity6

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLigase
Biological processFatty acid metabolism, Lipid metabolism
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001206

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Acyl-coenzyme A synthetase ACSM3, mitochondrial (EC:6.2.1.21 Publication)
Alternative name(s):
Acyl-CoA synthetase medium-chain family member 3
Butyrate--CoA ligase 3
Butyryl-coenzyme A synthetase 3
Middle-chain acyl-CoA synthetase 3
Propionate--CoA ligase (EC:6.2.1.171 Publication)
Protein SA homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Acsm3
Synonyms:Sa, Sah
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:99538, Acsm3

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000030935

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Mitochondrion

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 21MitochondrionSequence analysisAdd BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000030609822 – 580Acyl-coenzyme A synthetase ACSM3, mitochondrialAdd BLAST559

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei67N6-succinyllysineCombined sources1
Modified residuei100N6-succinyllysineCombined sources1
Modified residuei151N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3UNX5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3UNX5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3UNX5

PeptideAtlas

More...
PeptideAtlasi
Q3UNX5

PRoteomics IDEntifications database

More...
PRIDEi
Q3UNX5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
285713 [Q3UNX5-1]
285714 [Q3UNX5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3UNX5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3UNX5

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q3UNX5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in kidney (at protein level). Detected in kidney proximal tubules and in liver. Detected at low levels in testis, stomach, heart and lung.4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in kidney by androgens. Down-regulated in kidney by estrogens. Levels in kidney are very low in female C57BL/6 mice and in castrated male C57BL/6, 129/SvJ and BALB/c mice. Constitutively expressed in liver.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000030935, Expressed in proximal tubule and 149 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3UNX5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000068803

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3UNX5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3UNX5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1175, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157930

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000022_59_10_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3UNX5

Identification of Orthologs from Complete Genome Data

More...
OMAi
HAWSNLF

Database of Orthologous Groups

More...
OrthoDBi
683933at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3UNX5

TreeFam database of animal gene trees

More...
TreeFami
TF354287

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.12780, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025110, AMP-bd_C
IPR020845, AMP-binding_CS
IPR000873, AMP-dep_Synth/Lig
IPR042099, ANL_N_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00501, AMP-binding, 1 hit
PF13193, AMP-binding_C, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00455, AMP_BINDING, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q3UNX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVMLLRARCF QRLAIPDPMR VLYKDYRTAT PQNFSNYESM KQDFKIEIPE
60 70 80 90 100
YFNFAKDVLD QWTNMEKAGK RLSNPAFWWI DGNGEELRWS FEELGLLSRK
110 120 130 140 150
FANILTEACS LQRGDRVMVI LPKIPEWWLA NVACLRTGTV LIPGTTQLTQ
160 170 180 190 200
KDILYRLQSS KAKCIITDDT LAPAVDAVAA KCENLHSKLI VSQHSREGWG
210 220 230 240 250
NLKEMMKYAS DSHTCVDTKH DEMMAIYFTS GTTGPPKMIG HTHSSFGLGL
260 270 280 290 300
SVNGRFWLDL IASDVMWNTS DTGWAKSAWS SVFSPWTQGA CVFAHYLPRF
310 320 330 340 350
ESTSILQTLS KFPITVFCSA PTAYRMLVQN DMSSYKFNSL KHCVSAGEPI
360 370 380 390 400
NPEVMEQWRK KTGLDIYEGY GQTETVLICG NFKGMKIKPG SMGKPSPAFD
410 420 430 440 450
VKILDENGAT LPPGQEGDIA LQVLPERPFG LFTHYVDNPS KTASTLRGSF
460 470 480 490 500
YITGDRGYMD EDGYFWFVAR SDDIILSSGY RIGPFEVESA LIEHPSIAES
510 520 530 540 550
AVVSSPDPIR GEVVKAFIVL NPDYKSHDQE QLKKEIQEHV KKTTAPYKYP
560 570 580
RKVEFIEELP KTVSGKVKRN ELRKKEWVTT
Length:580
Mass (Da):65,623
Last modified:October 2, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCAF3D06A0B4A2778
GO
Isoform 2 (identifier: Q3UNX5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     578-580: VTT → EQGLLHEQMTVDRLLGKSARHERHVPSVCMNCSGVAAVLRYAEAA

Show »
Length:622
Mass (Da):70,238
Checksum:i4F98E4406704D0F2
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC79656 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH15248 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAL40880 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA37141 differs from that shown. Reason: Frameshift.Curated
The sequence BAE38232 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti137T → P in AAC79656 (PubMed:15525578).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028397578 – 580VTT → EQGLLHEQMTVDRLLGKSAR HERHVPSVCMNCSGVAAVLR YAEAA in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY064696 mRNA Translation: AAL40880.1 Different initiation.
AB022340 mRNA Translation: BAA37141.1 Frameshift.
AF068246 mRNA Translation: AAC79656.1 Different initiation.
AK041060 mRNA Translation: BAC30805.1
AK143946 mRNA Translation: BAE25622.1
AK165516 mRNA Translation: BAE38232.1 Different initiation.
BC015248 mRNA Translation: AAH15248.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS21786.1 [Q3UNX5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_058566.3, NM_016870.3 [Q3UNX5-1]
NP_997606.2, NM_212441.2 [Q3UNX5-1]
NP_997607.2, NM_212442.2 [Q3UNX5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000063770; ENSMUSP00000068803; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106526; ENSMUSP00000102136; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106527; ENSMUSP00000102137; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106528; ENSMUSP00000102138; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106529; ENSMUSP00000102139; ENSMUSG00000030935 [Q3UNX5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
20216

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:20216

UCSC genome browser

More...
UCSCi
uc009jlq.1, mouse [Q3UNX5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY064696 mRNA Translation: AAL40880.1 Different initiation.
AB022340 mRNA Translation: BAA37141.1 Frameshift.
AF068246 mRNA Translation: AAC79656.1 Different initiation.
AK041060 mRNA Translation: BAC30805.1
AK143946 mRNA Translation: BAE25622.1
AK165516 mRNA Translation: BAE38232.1 Different initiation.
BC015248 mRNA Translation: AAH15248.1 Different initiation.
CCDSiCCDS21786.1 [Q3UNX5-1]
RefSeqiNP_058566.3, NM_016870.3 [Q3UNX5-1]
NP_997606.2, NM_212441.2 [Q3UNX5-1]
NP_997607.2, NM_212442.2 [Q3UNX5-1]

3D structure databases

SMRiQ3UNX5
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000068803

Chemistry databases

SwissLipidsiSLP:000001206

PTM databases

iPTMnetiQ3UNX5
PhosphoSitePlusiQ3UNX5
SwissPalmiQ3UNX5

Proteomic databases

jPOSTiQ3UNX5
MaxQBiQ3UNX5
PaxDbiQ3UNX5
PeptideAtlasiQ3UNX5
PRIDEiQ3UNX5
ProteomicsDBi285713 [Q3UNX5-1]
285714 [Q3UNX5-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25607, 156 antibodies

The DNASU plasmid repository

More...
DNASUi
20216

Genome annotation databases

EnsembliENSMUST00000063770; ENSMUSP00000068803; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106526; ENSMUSP00000102136; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106527; ENSMUSP00000102137; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106528; ENSMUSP00000102138; ENSMUSG00000030935 [Q3UNX5-1]
ENSMUST00000106529; ENSMUSP00000102139; ENSMUSG00000030935 [Q3UNX5-2]
GeneIDi20216
KEGGimmu:20216
UCSCiuc009jlq.1, mouse [Q3UNX5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6296
MGIiMGI:99538, Acsm3
VEuPathDBiHostDB:ENSMUSG00000030935

Phylogenomic databases

eggNOGiKOG1175, Eukaryota
GeneTreeiENSGT00940000157930
HOGENOMiCLU_000022_59_10_1
InParanoidiQ3UNX5
OMAiHAWSNLF
OrthoDBi683933at2759
PhylomeDBiQ3UNX5
TreeFamiTF354287

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
20216, 1 hit in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Acsm3, mouse

Protein Ontology

More...
PROi
PR:Q3UNX5
RNActiQ3UNX5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000030935, Expressed in proximal tubule and 149 other tissues
GenevisibleiQ3UNX5, MM

Family and domain databases

Gene3Di3.40.50.12780, 1 hit
InterProiView protein in InterPro
IPR025110, AMP-bd_C
IPR020845, AMP-binding_CS
IPR000873, AMP-dep_Synth/Lig
IPR042099, ANL_N_sf
PfamiView protein in Pfam
PF00501, AMP-binding, 1 hit
PF13193, AMP-binding_C, 1 hit
PROSITEiView protein in PROSITE
PS00455, AMP_BINDING, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACSM3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UNX5
Secondary accession number(s): Q8BRY2
, Q91WI1, Q9Z2F3, Q9Z2X0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: September 29, 2021
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again