Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 101 (12 Aug 2020)
Sequence version 1 (11 Oct 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NTF2-related export protein 2

Gene

Nxt2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA transport, Protein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NTF2-related export protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nxt2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2147914, Nxt2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003782001 – 142NTF2-related export protein 2Add BLAST142

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3UNA4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3UNA4

PeptideAtlas

More...
PeptideAtlasi
Q3UNA4

PRoteomics IDEntifications database

More...
PRIDEi
Q3UNA4

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3UNA4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3UNA4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000042271, Expressed in proximal tubule and 241 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3UNA4, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with NXF1, NXF2, NXF3 and NXF5.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
231838, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000048221

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3UNA4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3UNA4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini17 – 136NTF2PROSITE-ProRule annotationAdd BLAST120

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4353, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156381

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_122448_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3UNA4

KEGG Orthology (KO)

More...
KOi
K14285

Database of Orthologous Groups

More...
OrthoDBi
1450028at2759

TreeFam database of animal gene trees

More...
TreeFami
TF318944

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00780, NTF2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002075, NTF2
IPR032710, NTF2-like_dom_sf
IPR018222, Nuclear_transport_factor_2_euk

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02136, NTF2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54427, SSF54427, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50177, NTF2_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q3UNA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALAVNFKTY VDQACRAAEE FVNIYYETMD KRRHALVRLY LDKATLIWNG
60 70 80 90 100
NVVTGLEALA NFFEMLPSSE FQINMLDCQP VHEQATQCQT TVLVVTSGVV
110 120 130 140
KFDGNKQHFF NQNFLLTAQS TPNSTVWKIA SDCFRFQDWA SI
Length:142
Mass (Da):16,257
Last modified:October 11, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i104CB5006E62A07C
GO
Isoform 2 (identifier: Q3UNA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKKFRSNWSNGDQHFGNSGSSWVEPQINYKYQRTQTSAEVRTSPGPALEQTISSPLM

Show »
Length:198
Mass (Da):22,568
Checksum:i7E4D7EA75848312C
GO
Isoform 3 (identifier: Q3UNA4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: Missing.

Show »
Length:114
Mass (Da):13,014
Checksum:iD6F2E7D5DEB80D5A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti11V → L in BAC27701 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0375281 – 28Missing in isoform 3. CuratedAdd BLAST28
Alternative sequenceiVSP_0375291M → MKKFRSNWSNGDQHFGNSGS SWVEPQINYKYQRTQTSAEV RTSPGPALEQTISSPLM in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK032102 mRNA Translation: BAC27701.1
AK144349 mRNA Translation: BAE25843.1
AL731672 Genomic DNA No translation available.
CH466610 Genomic DNA Translation: EDL14753.1
CH466610 Genomic DNA Translation: EDL14754.1
BC068166 mRNA Translation: AAH68166.2
BC094570 mRNA Translation: AAH94570.2
BC118503 mRNA Translation: AAI18504.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41155.1 [Q3UNA4-1]
CCDS72440.1 [Q3UNA4-2]
CCDS72441.1 [Q3UNA4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001154902.1, NM_001161430.2 [Q3UNA4-1]
NP_001277461.1, NM_001290532.1 [Q3UNA4-2]
NP_001277462.1, NM_001290533.1 [Q3UNA4-3]
NP_766370.2, NM_172782.4 [Q3UNA4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000042329; ENSMUSP00000048221; ENSMUSG00000042271 [Q3UNA4-1]
ENSMUST00000112913; ENSMUSP00000108535; ENSMUSG00000042271 [Q3UNA4-3]
ENSMUST00000112914; ENSMUSP00000108536; ENSMUSG00000042271 [Q3UNA4-1]
ENSMUST00000112916; ENSMUSP00000108538; ENSMUSG00000042271 [Q3UNA4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
237082

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:237082

UCSC genome browser

More...
UCSCi
uc009ulr.3, mouse [Q3UNA4-1]
uc057asw.1, mouse [Q3UNA4-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032102 mRNA Translation: BAC27701.1
AK144349 mRNA Translation: BAE25843.1
AL731672 Genomic DNA No translation available.
CH466610 Genomic DNA Translation: EDL14753.1
CH466610 Genomic DNA Translation: EDL14754.1
BC068166 mRNA Translation: AAH68166.2
BC094570 mRNA Translation: AAH94570.2
BC118503 mRNA Translation: AAI18504.1
CCDSiCCDS41155.1 [Q3UNA4-1]
CCDS72440.1 [Q3UNA4-2]
CCDS72441.1 [Q3UNA4-3]
RefSeqiNP_001154902.1, NM_001161430.2 [Q3UNA4-1]
NP_001277461.1, NM_001290532.1 [Q3UNA4-2]
NP_001277462.1, NM_001290533.1 [Q3UNA4-3]
NP_766370.2, NM_172782.4 [Q3UNA4-1]

3D structure databases

SMRiQ3UNA4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi231838, 4 interactors
STRINGi10090.ENSMUSP00000048221

PTM databases

iPTMnetiQ3UNA4
PhosphoSitePlusiQ3UNA4

Proteomic databases

MaxQBiQ3UNA4
PaxDbiQ3UNA4
PeptideAtlasiQ3UNA4
PRIDEiQ3UNA4

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
15334, 37 antibodies

Genome annotation databases

EnsembliENSMUST00000042329; ENSMUSP00000048221; ENSMUSG00000042271 [Q3UNA4-1]
ENSMUST00000112913; ENSMUSP00000108535; ENSMUSG00000042271 [Q3UNA4-3]
ENSMUST00000112914; ENSMUSP00000108536; ENSMUSG00000042271 [Q3UNA4-1]
ENSMUST00000112916; ENSMUSP00000108538; ENSMUSG00000042271 [Q3UNA4-2]
GeneIDi237082
KEGGimmu:237082
UCSCiuc009ulr.3, mouse [Q3UNA4-1]
uc057asw.1, mouse [Q3UNA4-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55916
MGIiMGI:2147914, Nxt2

Phylogenomic databases

eggNOGiKOG4353, Eukaryota
GeneTreeiENSGT00940000156381
HOGENOMiCLU_122448_1_0_1
InParanoidiQ3UNA4
KOiK14285
OrthoDBi1450028at2759
TreeFamiTF318944

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
237082, 1 hit in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Nxt2, mouse

Protein Ontology

More...
PROi
PR:Q3UNA4
RNActiQ3UNA4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000042271, Expressed in proximal tubule and 241 other tissues
GenevisibleiQ3UNA4, MM

Family and domain databases

CDDicd00780, NTF2, 1 hit
InterProiView protein in InterPro
IPR002075, NTF2
IPR032710, NTF2-like_dom_sf
IPR018222, Nuclear_transport_factor_2_euk
PfamiView protein in Pfam
PF02136, NTF2, 1 hit
SUPFAMiSSF54427, SSF54427, 1 hit
PROSITEiView protein in PROSITE
PS50177, NTF2_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNXT2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UNA4
Secondary accession number(s): B1AVX3
, B1AVX5, Q505F8, Q6NVE1, Q8C070
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 16, 2009
Last sequence update: October 11, 2005
Last modified: August 12, 2020
This is version 101 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again