Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 105 (12 Aug 2020)
Sequence version 2 (28 Nov 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cordon-bleu protein-like 1

Gene

Cobll1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cordon-bleu protein-like 1Curated
Alternative name(s):
Cobl-related protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cobll1Imported
Synonyms:Coblr1, Kiaa0977
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2442894, Cobll1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002604941 – 1273Cordon-bleu protein-like 1Add BLAST1273

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei183PhosphothreonineCombined sources1
Modified residuei248PhosphoserineBy similarity1
Modified residuei266PhosphoserineBy similarity1
Modified residuei300PhosphoserineCombined sources1
Modified residuei304PhosphothreonineCombined sources1
Modified residuei317PhosphoserineBy similarity1
Modified residuei328PhosphothreonineCombined sources1
Modified residuei366PhosphoserineCombined sources1
Modified residuei373PhosphoserineCombined sources1
Modified residuei374PhosphoserineCombined sources1
Modified residuei384PhosphoserineBy similarity1
Modified residuei396PhosphoserineCombined sources1
Modified residuei518PhosphoserineBy similarity1
Modified residuei521PhosphoserineBy similarity1
Modified residuei541PhosphoserineCombined sources1
Modified residuei546PhosphoserineCombined sources1
Modified residuei551PhosphoserineCombined sources1
Modified residuei554PhosphoserineCombined sources1
Modified residuei645PhosphoserineCombined sources1
Modified residuei666PhosphoserineCombined sources1
Modified residuei770PhosphoserineCombined sources1
Modified residuei869PhosphoserineBy similarity1
Modified residuei896PhosphoserineCombined sources1
Modified residuei897PhosphoserineCombined sources1
Modified residuei993PhosphoserineCombined sources1
Modified residuei999PhosphoserineBy similarity1
Modified residuei1028PhosphoserineCombined sources1
Modified residuei1092PhosphoserineCombined sources1
Modified residuei1214PhosphoserineCombined sources1
Modified residuei1215PhosphoserineCombined sources1
Modified residuei1266PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3UMF0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3UMF0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3UMF0

PeptideAtlas

More...
PeptideAtlasi
Q3UMF0

PRoteomics IDEntifications database

More...
PRIDEi
Q3UMF0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3UMF0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3UMF0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in embryonic first branchial arc, branchial clefts and limb buds.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000034903, Expressed in adrenal gland and 265 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3UMF0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3UMF0, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
235590, 24 interactors

Protein interaction database and analysis system

More...
IntActi
Q3UMF0, 15 interactors

Molecular INTeraction database

More...
MINTi
Q3UMF0

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000099787

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3UMF0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3UMF0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1226 – 1246WH2Add BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi335 – 340KKRRAP 16
Motifi400 – 405KKRRAP 26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi974 – 1104Pro-richAdd BLAST131

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3751, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063608

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003305_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3UMF0

KEGG Orthology (KO)

More...
KOi
K24046

Database of Orthologous Groups

More...
OrthoDBi
986623at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3UMF0

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039895, COBL-like
IPR019025, Cordon-bleu_ubiquitin_domain

The PANTHER Classification System

More...
PANTHERi
PTHR21557, PTHR21557, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09469, Cobl, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3UMF0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRSVPDPLP RSAPRTPAMQ PAGSAGKRRF MKMFHAHSKN DFVRIKNHKF
60 70 80 90 100
LPLHICQSRK TKGKAPLPPA ETKGTDVSSA EDPVESTAVV TEQQDNMIDK
110 120 130 140 150
DIELSVVLPG DILKSTTVHG SKPMMDLLVF LCAQYHLNPS SHTIDLLSAE
160 170 180 190 200
ENLIKFKPNT PIGMLDVEKV ILKPKSLDKK KPTPIIPEKT VRVVINFKKT
210 220 230 240 250
QKTIVRVSPH APLQDLAPII CSKCEFDPLH TVLLKDYQAQ EPLDLTKSLN
260 270 280 290 300
DLGLRELYAM DISRESCQIS HNPDIVKEKE NKGIFSFFQR SKKKREQTAS
310 320 330 340 350
APATPLVSKH RPSFTRSNTI SKPYISNTLP SDAPKKRRAP LPPMPTSQGA
360 370 380 390 400
AQGQERRASC VERSTSVDDT DKSSSEAIMV RTGSLQLSST SIGTSSLKRT
410 420 430 440 450
KRKAPAPPSK TPLAQTDERN SAMAHGLPLE DGIAPDSMLE LSSPEGMSTP
460 470 480 490 500
EGSLGPGFLS QEQCAVPKPP DEISEGPGTP ETAVASLTSG VSSDYSLEEI
510 520 530 540 550
DEKEELSEAS KDPAGSISVK SPDIASASTD MRITVEKDPD SALGISDGET
560 570 580 590 600
SPSSKGKTQE GRSTEGQGPY HPVVGHIGNE DRVSDSIKDM KTLGPNQESV
610 620 630 640 650
VQNEIMVCAT STDYVKNRPG KMETTIEGEG EALKKASDME TDRLSGSPAC
660 670 680 690 700
RMDNVKSSRE NHLTASPGPD QKLNQPGVEK TKMQDAAIQA TPARGTFDGN
710 720 730 740 750
HEVSNSSDPR ADETVQTSDG SISAQHSSAS LQDSVNASRE FRSQGTSTYV
760 770 780 790 800
QDRLPEKEPA CTYGNNVPLS PVDGSNKNPA ASYLKNFPLY RQDSNPKPKP
810 820 830 840 850
SNEITREYIP KIGMTTYKIV PPKSLEMAKD WESEAMGRKD DQKMLPVGQR
860 870 880 890 900
HTIENMTETS MQTEVPATSK SSQQPQPDLK PKPSSGTERH LHRTLSSPTG
910 920 930 940 950
TETNPPKAPR VTTDTGTIPF APNLEDINNI LESKFRSRAS NPQAKPSSFF
960 970 980 990 1000
LQMQKRASGH YVTSAAAKSV HTAPGPAPKE PTIKEVQRDP QLSPEQHPSS
1010 1020 1030 1040 1050
LSERTHSAPL PNISKADDDI IQKPAETSPP PVAPKPMTLR AETSPPPVFP
1060 1070 1080 1090 1100
KPMTLPAETS PPPVFPKPMT LPAETSLPLV FPKPMTLRAE TSPPPVAAKP
1110 1120 1130 1140 1150
VALPGSQGTS LNLKTLKTFG APRPYSSSGP SPFALAVVKR SQSFSKACPE
1160 1170 1180 1190 1200
SASEGSSALP PAATQDEKTH TVNKPTVGSQ HGDGDKQNNP VQNEHSSQVL
1210 1220 1230 1240 1250
TPADGPSFTL KRQSSLTFQS SDPEHVRQSL LTAIRSGEAA AKLKRVTVPS
1260 1270
NTISVNGKSG LSQSMSIDAQ DSR
Length:1,273
Mass (Da):137,382
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBCC8C8B21D8D87BF
GO
Isoform 2 (identifier: Q3UMF0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-58: Missing.

Show »
Length:1,241
Mass (Da):133,404
Checksum:i50D93A599757A004
GO
Isoform 3 (identifier: Q3UMF0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-59: Missing.
     451-489: EGSLGPGFLSQEQCAVPKPPDEISEGPGTPETAVASLTS → A

Show »
Length:1,202
Mass (Da):129,452
Checksum:i8736B937DDF3389B
GO
Isoform 4 (identifier: Q3UMF0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-58: Missing.
     451-489: EGSLGPGFLSQEQCAVPKPPDEISEGPGTPETAVASLTS → A

Show »
Length:1,203
Mass (Da):129,609
Checksum:i1DE5557BE842432B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AZ15B1AZ15_MOUSE
Cordon-bleu protein-like 1
Cobll1
1,240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AZ26B1AZ26_MOUSE
Cordon-bleu protein-like 1
Cobll1
346Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AZ14B1AZ14_MOUSE
Cordon-bleu protein-like 1
Cobll1
1,241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AZ20B1AZ20_MOUSE
Cordon-bleu protein-like 1
Cobll1
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AZ25B1AZ25_MOUSE
Cordon-bleu protein-like 1
Cobll1
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH67007 differs from that shown. Reason: Frameshift.Curated
The sequence BAC35029 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD32354 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti9L → V in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti211A → T in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti392I → V in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti482T → A in AAP74342 (PubMed:14512015).Curated1
Sequence conflicti557K → N in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti575G → C in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti600Missing in AAP74342 (PubMed:14512015).Curated1
Sequence conflicti600Missing in BAE22700 (PubMed:16141072).Curated1
Sequence conflicti654N → S in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti695G → D in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti730 – 731SL → NV in BAE26148 (PubMed:16141072).Curated2
Sequence conflicti812I → V in BAC35029 (PubMed:16141072).Curated1
Sequence conflicti828A → V in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti836M → V in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti850R → K in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti908A → P in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti997H → R in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti1040R → P in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti1049 – 1050FP → AA in BAE26148 (PubMed:16141072).Curated2
Sequence conflicti1053 – 1054MT → VA in BAE26148 (PubMed:16141072).Curated2
Sequence conflicti1065F → A in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti1079L → P in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti1176T → M in BAE26148 (PubMed:16141072).Curated1
Sequence conflicti1184G → V in BAE26148 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02232427 – 59Missing in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_02162627 – 58Missing in isoform 2 and isoform 4. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_021627451 – 489EGSLG…ASLTS → A in isoform 3 and isoform 4. 3 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY308746 mRNA Translation: AAP74342.1
AK173076 mRNA Translation: BAD32354.1 Different initiation.
AK052533 mRNA Translation: BAC35029.1 Different initiation.
AK135859 mRNA Translation: BAE22700.1
AK144943 mRNA Translation: BAE26148.1
BC067007 mRNA Translation: AAH67007.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS50595.1 [Q3UMF0-4]
CCDS89492.1 [Q3UMF0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_081501.1, NM_027225.1 [Q3UMF0-4]
NP_795999.2, NM_177025.5
XP_017174487.1, XM_017318998.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000090896; ENSMUSP00000088412; ENSMUSG00000034903 [Q3UMF0-4]
ENSMUST00000112430; ENSMUSP00000108049; ENSMUSG00000034903 [Q3UMF0-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
319876

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:319876

UCSC genome browser

More...
UCSCi
uc008jvz.2, mouse [Q3UMF0-3]
uc008jwc.2, mouse [Q3UMF0-4]
uc008jwe.1, mouse [Q3UMF0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY308746 mRNA Translation: AAP74342.1
AK173076 mRNA Translation: BAD32354.1 Different initiation.
AK052533 mRNA Translation: BAC35029.1 Different initiation.
AK135859 mRNA Translation: BAE22700.1
AK144943 mRNA Translation: BAE26148.1
BC067007 mRNA Translation: AAH67007.1 Frameshift.
CCDSiCCDS50595.1 [Q3UMF0-4]
CCDS89492.1 [Q3UMF0-2]
RefSeqiNP_081501.1, NM_027225.1 [Q3UMF0-4]
NP_795999.2, NM_177025.5
XP_017174487.1, XM_017318998.1

3D structure databases

SMRiQ3UMF0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi235590, 24 interactors
IntActiQ3UMF0, 15 interactors
MINTiQ3UMF0
STRINGi10090.ENSMUSP00000099787

PTM databases

iPTMnetiQ3UMF0
PhosphoSitePlusiQ3UMF0

Proteomic databases

jPOSTiQ3UMF0
MaxQBiQ3UMF0
PaxDbiQ3UMF0
PeptideAtlasiQ3UMF0
PRIDEiQ3UMF0

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33758, 152 antibodies

Genome annotation databases

EnsembliENSMUST00000090896; ENSMUSP00000088412; ENSMUSG00000034903 [Q3UMF0-4]
ENSMUST00000112430; ENSMUSP00000108049; ENSMUSG00000034903 [Q3UMF0-3]
GeneIDi319876
KEGGimmu:319876
UCSCiuc008jvz.2, mouse [Q3UMF0-3]
uc008jwc.2, mouse [Q3UMF0-4]
uc008jwe.1, mouse [Q3UMF0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22837
MGIiMGI:2442894, Cobll1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3751, Eukaryota
GeneTreeiENSGT00530000063608
HOGENOMiCLU_003305_0_0_1
InParanoidiQ3UMF0
KOiK24046
OrthoDBi986623at2759
PhylomeDBiQ3UMF0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
319876, 0 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Cobll1, mouse

Protein Ontology

More...
PROi
PR:Q3UMF0
RNActiQ3UMF0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000034903, Expressed in adrenal gland and 265 other tissues
ExpressionAtlasiQ3UMF0, baseline and differential
GenevisibleiQ3UMF0, MM

Family and domain databases

InterProiView protein in InterPro
IPR039895, COBL-like
IPR019025, Cordon-bleu_ubiquitin_domain
PANTHERiPTHR21557, PTHR21557, 1 hit
PfamiView protein in Pfam
PF09469, Cobl, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOBL1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UMF0
Secondary accession number(s): Q3UX63
, Q69ZU2, Q6NXM0, Q7TQM8, Q8BWH3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: August 12, 2020
This is version 105 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again