Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (07 Oct 2020)
Sequence version 2 (31 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Teneurin-4

Gene

Tenm4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Plays a role in the establishment of the anterior-posterior axis during gastrulation. Regulates the differentiation and cellular process formation of oligodendrocytes and myelination of small-diameter axons in the central nervous system (CNS). Promotes activation of focal adhesion kinase. May function as a cellular signal transducer.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Teneurin-4
Short name:
Ten-4
Alternative name(s):
Downstream of CHOP4
Protein Odd Oz/ten-m homolog 4
Tenascin-M4
Short name:
Ten-m4
Teneurin transmembrane protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tenm4
Synonyms:Doc4, Kiaa1302, Odz4, Tnm4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2447063, Tenm4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 345CytoplasmicSequence analysisAdd BLAST345
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei346 – 366HelicalSequence analysisAdd BLAST21
Topological domaini367 – 2771ExtracellularSequence analysisAdd BLAST2405

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice show tremors and hypomyelination in the central nervous system (CNS), particularly in the spinal cord, but not in the sciatic nerve of the peripheral nervous system (PNS). Differentiation of oligodendrocytes is prevented in the spinal cord.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002595091 – 2771Teneurin-4Add BLAST2771

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei124PhosphoserineCombined sources1
Modified residuei178PhosphothreonineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi469N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi568 ↔ 578PROSITE-ProRule annotation
Disulfide bondi572 ↔ 583PROSITE-ProRule annotation
Disulfide bondi585 ↔ 594PROSITE-ProRule annotation
Disulfide bondi603 ↔ 614PROSITE-ProRule annotation
Disulfide bondi616 ↔ 625PROSITE-ProRule annotation
Disulfide bondi632 ↔ 643PROSITE-ProRule annotation
Disulfide bondi637 ↔ 648PROSITE-ProRule annotation
Disulfide bondi650 ↔ 659PROSITE-ProRule annotation
Disulfide bondi664 ↔ 675PROSITE-ProRule annotation
Disulfide bondi669 ↔ 680PROSITE-ProRule annotation
Disulfide bondi682 ↔ 691PROSITE-ProRule annotation
Disulfide bondi702 ↔ 715PROSITE-ProRule annotation
Disulfide bondi717 ↔ 726PROSITE-ProRule annotation
Disulfide bondi731 ↔ 741PROSITE-ProRule annotation
Disulfide bondi735 ↔ 746PROSITE-ProRule annotation
Disulfide bondi748 ↔ 757PROSITE-ProRule annotation
Disulfide bondi762 ↔ 772PROSITE-ProRule annotation
Disulfide bondi766 ↔ 777PROSITE-ProRule annotation
Disulfide bondi779 ↔ 788PROSITE-ProRule annotation
Disulfide bondi802 ↔ 812PROSITE-ProRule annotation
Disulfide bondi806 ↔ 821PROSITE-ProRule annotation
Disulfide bondi823 ↔ 832PROSITE-ProRule annotation
Glycosylationi942N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1261N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1611N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1707N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi1743N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1801N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1886N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1987N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2190N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi2330N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2648N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3UHK6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3UHK6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3UHK6

PeptideAtlas

More...
PeptideAtlasi
Q3UHK6

PRoteomics IDEntifications database

More...
PRIDEi
Q3UHK6

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2432, 3 N-Linked glycans (4 sites) [Q3UHK6-2]

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q3UHK6, 12 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3UHK6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3UHK6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q3UHK6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and spinal cord (at protein level). Expressed in neurons and oligodendrocytes of the spinal cord. Expressed weakly in kidney, lung and spleen. Expressed in the cortex, CA1, CA2 and CA3 of the hippocampus. Expressed in the white matter, Purkinje cells and molecular layer of the cerebellum.3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in spinal cord at 18 dpc (at protein level). Expressed in the epiblast and extraembryonic regions as early as 6.5 dpc. Expressed in the neural plate and extraembryonic tissues at 7.5 dpc. Expressed in the forebrain, mid/hindbrain junction, somites and tail bud at 8.5 dpc. Expressed in the tail bud and limbs at 11.5 dpc. Expressed in the diencephalon and midbrain at 12.5 dpc.3 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during oligodendrocyte differentiation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000048078, Expressed in cumulus cell and 263 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3UHK6, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; disulfide-linked. May also form heterodimer with either TENM1 or TENM2 or TENM3.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
204827, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q3UHK6, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000102783

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3UHK6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3UHK6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 341Teneurin N-terminalPROSITE-ProRule annotationAdd BLAST341
Domaini564 – 595EGF-like 1PROSITE-ProRule annotationAdd BLAST32
Domaini596 – 626EGF-like 2PROSITE-ProRule annotationAdd BLAST31
Domaini628 – 660EGF-like 3PROSITE-ProRule annotationAdd BLAST33
Domaini661 – 692EGF-like 4PROSITE-ProRule annotationAdd BLAST32
Domaini694 – 727EGF-like 5PROSITE-ProRule annotationAdd BLAST34
Domaini728 – 759EGF-like 6PROSITE-ProRule annotationAdd BLAST32
Domaini760 – 789EGF-like 7PROSITE-ProRule annotationAdd BLAST30
Domaini790 – 833EGF-like 8PROSITE-ProRule annotationAdd BLAST44
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1218 – 1261NHL 1Add BLAST44
Repeati1266 – 1310NHL 2Add BLAST45
Repeati1336 – 1380NHL 3Add BLAST45
Repeati1395 – 1446NHL 4Add BLAST52
Repeati1525 – 1568NHL 5Add BLAST44
Repeati1578 – 1597YD 1Add BLAST20
Repeati1614 – 1634YD 2Add BLAST21
Repeati1677 – 1696YD 3Add BLAST20
Repeati1697 – 1719YD 4Add BLAST23
Repeati1889 – 1908YD 5Add BLAST20
Repeati1930 – 1948YD 6Add BLAST19
Repeati1949 – 1969YD 7Add BLAST21
Repeati1976 – 1993YD 8Add BLAST18
Repeati1994 – 2015YD 9Add BLAST22
Repeati2016 – 2033YD 10Add BLAST18
Repeati2036 – 2056YD 11Add BLAST21
Repeati2059 – 2079YD 12Add BLAST21
Repeati2087 – 2106YD 13Add BLAST20
Repeati2112 – 2129YD 14Add BLAST18
Repeati2130 – 2156YD 15Add BLAST27
Repeati2158 – 2171YD 16Add BLAST14
Repeati2172 – 2195YD 17Add BLAST24
Repeati2198 – 2218YD 18Add BLAST21
Repeati2219 – 2239YD 19Add BLAST21
Repeati2241 – 2261YD 20Add BLAST21
Repeati2273 – 2293YD 21Add BLAST21
Repeati2295 – 2315YD 22Add BLAST21
Repeati2341 – 2382YD 23Add BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi179 – 184Poly-Pro6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

EGF-like domains 2 and 5 which have an odd number of cysteines might enable the formation of intermolecular disulfide bonds.
Cytoplasmic proline-rich regions could serve as docking domains for intracellular SH3-containing proteins.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tenascin family. Teneurin subfamily.Curated

Keywords - Domaini

EGF-like domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4659, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT01000000214453

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000229_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3UHK6

Identification of Orthologs from Complete Genome Data

More...
OMAi
IAGMDTH

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3UHK6

TreeFam database of animal gene trees

More...
TreeFami
TF316833

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.120.10.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011042, 6-blade_b-propeller_TolB-like
IPR008969, CarboxyPept-like_regulatory
IPR000742, EGF-like_dom
IPR013111, EGF_extracell
IPR022385, Rhs_assc_core
IPR031325, RHS_repeat
IPR027691, Ten-4
IPR009471, Ten_N
IPR028916, Tox-GHH_dom
IPR006530, YD

The PANTHER Classification System

More...
PANTHERi
PTHR11219:SF9, PTHR11219:SF9, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07974, EGF_2, 1 hit
PF05593, RHS_repeat, 1 hit
PF06484, Ten_N, 2 hits
PF15636, Tox-GHH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181, EGF, 8 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49464, SSF49464, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR03696, Rhs_assc_core, 1 hit
TIGR01643, YD_repeat_2x, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00022, EGF_1, 8 hits
PS01186, EGF_2, 7 hits
PS50026, EGF_3, 5 hits
PS51361, TENEURIN_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional mRNAs also exist. Tissue-specific expression of isoforms was observed throughout embryogenesis and in the brain and ovary adult tissues.

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3UHK6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVKERKPYR SLTRRRDAER RYTSSSADSE EGKGPQKSYS SSETLKAYDQ
60 70 80 90 100
DARLAYGSRV KDMVPQEAEE FCRTGTNFTL RELGLGEMTP PHGTLYRTDI
110 120 130 140 150
GLPHCGYSMG ASSDADLEAD TVLSPEHPVR LWGRSTRSGR SSCLSSRANS
160 170 180 190 200
NLTLTDTEHE NTETDHPSSL QNHPRLRTPP PPLPHAHTPN QHHAASINSL
210 220 230 240 250
NRGNFTPRSN PSPAPTDHSL SGEPPAGSAQ EPTHAQDNWL LNSNIPLETR
260 270 280 290 300
NLGKQPFLGT LQDNLIEMDI LSASRHDGAY SDGHFLFKPG GTSPLFCTTS
310 320 330 340 350
PGYPLTSSTV YSPPPRPLPR STFSRPAFNL KKPSKYCNWK CAALSAILIS
360 370 380 390 400
ATLVILLAYF VAMHLFGLNW HLQPMEGQMQ MYEITEDTAS SWPVPTDVSL
410 420 430 440 450
YPSGGTGLET PDRKGKGAAE GKPSSLFPED SFIDSGEIDV GRRASQKIPP
460 470 480 490 500
GTFWRSQVFI DHPVHLKFNV SLGKAALVGI YGRKGLPPSH TQFDFVELLD
510 520 530 540 550
GRRLLTQEAR SLEGPQRQSR GPVPPSSHET GFIQYLDSGI WHLAFYNDGK
560 570 580 590 600
ESEVVSFLTT AIESVDNCPS NCYGNGDCIS GTCHCFLGFL GPDCGRASCP
610 620 630 640 650
VLCSGNGQYM KGRCLCHSGW KGAECDVPTN QCIDVACSSH GTCIMGTCIC
660 670 680 690 700
NPGYKGESCE EVDCMDPTCS SRGVCVRGEC HCSVGWGGTN CETPRATCLD
710 720 730 740 750
QCSGHGTFLP DTGLCNCDPS WTGHDCSIEI CAADCGGHGV CVGGTCRCED
760 770 780 790 800
GWMGAACDQR ACHPRCAEHG TCRDGKCECS PGWNGEHCTI AHYLDRVVKE
810 820 830 840 850
GCPGLCNGNG RCTLDLNGWH CVCQLGWRGT GCDTSMETGC GDGKDNDGDG
860 870 880 890 900
LVDCMDPDCC LQPLCHVNPL CLGSPDPLDI IQETQAPVSQ QNLNSFYDRI
910 920 930 940 950
KFLVGRDSTH SIPGENPFDG GHACVIRGQV MTSDGTPLVG VNISFINNPL
960 970 980 990 1000
FGYTISRQDG SFDLVTNGGI SIILRFERAP FITQEHTLWL PWDRFFVMET
1010 1020 1030 1040 1050
IVMRHEENEI PSCDLSNFAR PNPVVSPSPL TSFASSCAEK GPIVPEIQAL
1060 1070 1080 1090 1100
QEEIVIAGCK MRLSYLSSRT PGYKSVLRIS LTHPTIPFNL MKVHLMVAVE
1110 1120 1130 1140 1150
GRLFRKWFAA APDLSYYFIW DKTDVYNQKV FGLSEAFVSV GYEYESCPDL
1160 1170 1180 1190 1200
ILWEKRTAVL QGYEIDASKL GGWSLDKHHA LNIQSGILHK GNGENQFVSQ
1210 1220 1230 1240 1250
QPPVIGSIMG NGRRRSISCP SCNGLADGNK LLAPVALTCG SDGSLYVGDF
1260 1270 1280 1290 1300
NYIRRIFPSG NVTNILEMRN KDFRHSHSPA HKYYLATDPM SGAVFLSDTN
1310 1320 1330 1340 1350
SRRVFKVKST TVVKDLVKNS EVVAGTGDQC LPFDDTRCGD GGKATEATLT
1360 1370 1380 1390 1400
NPRGITVDKF GLIYFVDGTM IRRVDQNGII STLLGSNDLT SARPLSCDSV
1410 1420 1430 1440 1450
MEISQVRLEW PTDLAINPMD NSLYVLDNNV VLQISENHQV RIVAGRPMHC
1460 1470 1480 1490 1500
QVPGIDHFLL SKVAIHATLE SATALAVSHN GVLYIAETDE KKINRIRQVT
1510 1520 1530 1540 1550
TSGEISLVAG APSGCDCKND ANCDCFSGDD GYAKDAKLNT PSSLAVCADG
1560 1570 1580 1590 1600
ELYVADLGNI RIRFIRKNKP FLNTQNMYEL SSPIDQELYL FDTSGKHLYT
1610 1620 1630 1640 1650
QSLPTGDYLY NFTYTGDGDI THITDNNGNM VNVRRDSTGM PLWLVVPDGQ
1660 1670 1680 1690 1700
VYWVTMGTNS ALRSVTTQGH ELAMMTYHGN SGLLATKSNE NGWTTFYEYD
1710 1720 1730 1740 1750
SFGRLTNVTF PTGQVSSFRS DTDSSVHVQV ETSSKDDVTI TTNLSASGAF
1760 1770 1780 1790 1800
YTLLQDQVRN SYYIGADGSL RLLLANGMEV ALQTEPHLLA GTVNPTVGKR
1810 1820 1830 1840 1850
NVTLPIDNGL NLVEWRQRKE QARGQVTVFG RRLRVHNRNL LSLDFDRVTR
1860 1870 1880 1890 1900
TEKIYDDHRK FTLRILYDQA GRPSLWSPSS RLNGVNVTYS PGGHIAGIQR
1910 1920 1930 1940 1950
GIMSERMEYD QAGRITSRIF ADGKMWSYTY LEKSMVLHLH SQRQYIFEFD
1960 1970 1980 1990 2000
KNDRLSSVTM PNVARQTLET IRSVGYYRNI YQPPEGNASV IQDFTEDGHL
2010 2020 2030 2040 2050
LHTFYLGTGR RVIYKYGKLS KLAETLYDTT KVSFTYDETA GMLKTVNLQN
2060 2070 2080 2090 2100
EGFTCTIRYR QIGPLIDRQI FRFTEEGMVN ARFDYNYDNS FRVTSMQAVI
2110 2120 2130 2140 2150
NETPLPIDLY RYDDVSGKTE QFGKFGVIYY DINQIITTAV MTHTKHFDAY
2160 2170 2180 2190 2200
GRMKEVQYEI FRSLMYWMTV QYDNMGRVVK KELKVGPYAN TTRYSYEYDA
2210 2220 2230 2240 2250
DGQLQTVSIN DKPLWRYSYD LNGNLHLLSP GNSARLTPLR YDLRDRITRL
2260 2270 2280 2290 2300
GDVQYKMDED GFLRQRGGDV FEYNSAGLLI KAYNRASGWS VRYRYDGLGR
2310 2320 2330 2340 2350
RVSSKSSHSH HLQFFYADLT NPTKVTHLYN HSSSEITSLY YDLQGHLFAM
2360 2370 2380 2390 2400
ELSSGDEFYI ACDNIGTPLA VFSGTGLMIK QILYTAYGEI YMDTNPNFQI
2410 2420 2430 2440 2450
IIGYHGGLYD PLTKLVHMGR RDYDVLAGRW TSPDHELWKR LSSNSIVPFH
2460 2470 2480 2490 2500
LYMFKNNNPI SNSQDIKCFM TDVNSWLLTF GFQLHNVIPG YPKPDTDAME
2510 2520 2530 2540 2550
PSYELVHTQM KTQEWDNSKS ILGVQCEVQK QLKAFVTLER FDQLYGSTIT
2560 2570 2580 2590 2600
SCQQAPETKK FASSGSIFGK GVKFALKDGR VTTDIISVAN EDGRRIAAIL
2610 2620 2630 2640 2650
NNAHYLENLH FTIDGVDTHY FVKPGPSEGD LAILGLSGGR RTLENGVNVT
2660 2670 2680 2690 2700
VSQINTVLSG RTRRYTDIQL QYRALCLNTR YGTTVDEEKV RVLELARQRA
2710 2720 2730 2740 2750
VRQAWAREQQ RLREGEEGLR AWTDGEKQQV LNTGRVQGYD GFFVTSVEQY
2760 2770
PELSDSANNI HFMRQSEMGR R
Length:2,771
Mass (Da):308,425
Last modified:October 31, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i15EF31E25A171FD0
GO
Isoform 2 (identifier: Q3UHK6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     791-799: Missing.
     1269-1275: Missing.

Show »
Length:2,825
Mass (Da):313,428
Checksum:i820622CCE037744E
GO
Isoform 3 (identifier: Q3UHK6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM
     164-164: T → TGAPLHCSSASSTPIEQSPSPPPSPPANESQRRLLGNGVAQPTPDSDSEEEFVPNSFLVKSGSASLGVAAN
     251-283: Missing.

Show »
Length:2,833
Mass (Da):314,673
Checksum:i1578D6B6F3E079B1
GO
Isoform 4 (identifier: Q3UHK6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPDHSALSAARAQFVDVEEREPEAM

Show »
Length:2,796
Mass (Da):311,192
Checksum:i70437010F777878E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YVP2D3YVP2_MOUSE
Teneurin-4
Tenm4 Odz4
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6UP10F6UP10_MOUSE
Teneurin-4
Tenm4 Odz4
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RNZ7A0A0U1RNZ7_MOUSE
Teneurin-4
Tenm4
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti136 – 137TR → EK in BAE36695 (PubMed:16141072).Curated2
Sequence conflicti152 – 164LTLTD…ENTET → EKSGSASLGVAAN in BAE36695 (PubMed:16141072).CuratedAdd BLAST13
Sequence conflicti240L → V in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti244N → K in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti247L → V in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti261L → W in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti271L → F in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti276H → R in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti286L → F in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti422 – 429KPSSLFPE → RVAALSVL in BAE36695 (PubMed:16141072).Curated8
Sequence conflicti493F → L in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti780S → T in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti895S → P in BAA77399 (PubMed:10225957).Curated1
Sequence conflicti1013C → R in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1039E → G in BAE28005 (PubMed:16141072).Curated1
Sequence conflicti1077L → V in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1133L → F in BAA77399 (PubMed:10225957).Curated1
Sequence conflicti1457H → Q in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1743N → H in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1746A → G in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1831R → P in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1875L → F in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti1952N → D in BAE28005 (PubMed:16141072).Curated1
Sequence conflicti2144T → S in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2160I → T in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2256K → R in BAE28005 (PubMed:16141072).Curated1
Sequence conflicti2262F → S in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2330N → S in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2657V → M in AAC31807 (PubMed:9649432).Curated1
Sequence conflicti2657V → M in BAA77399 (PubMed:10225957).Curated1
Sequence conflicti2657V → M in BAC65772 (PubMed:12693553).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0214041M → MEPDHSALSAARAQFVDVEE REPEAM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_021405164T → TGAPLHCSSASSTPIEQSPS PPPSPPANESQRRLLGNGVA QPTPDSDSEEEFVPNSFLVK SGSASLGVAAN in isoform 2 and isoform 3. 2 Publications1
Alternative sequenceiVSP_021406251 – 283Missing in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_021407791 – 799Missing in isoform 2. 1 Publication9
Alternative sequenceiVSP_0214081269 – 1275Missing in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF059485 mRNA Translation: AAC31807.1
AB025413 mRNA Translation: BAA77399.1
AK147579 mRNA Translation: BAE28005.1
AK147329 mRNA Translation: BAE27851.1
AK162046 mRNA Translation: BAE36695.1
AK122490 mRNA Translation: BAC65772.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40024.1 [Q3UHK6-4]
CCDS80753.1 [Q3UHK6-3]
CCDS80754.1 [Q3UHK6-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T14271

NCBI Reference Sequences

More...
RefSeqi
NP_001297689.1, NM_001310760.1 [Q3UHK6-3]
NP_001297691.1, NM_001310762.1 [Q3UHK6-2]
NP_035988.2, NM_011858.4 [Q3UHK6-4]
XP_017177717.1, XM_017322228.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000107162; ENSMUSP00000102780; ENSMUSG00000048078 [Q3UHK6-2]
ENSMUST00000107165; ENSMUSP00000102783; ENSMUSG00000048078 [Q3UHK6-3]
ENSMUST00000107166; ENSMUSP00000102784; ENSMUSG00000048078 [Q3UHK6-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23966

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:23966

UCSC genome browser

More...
UCSCi
uc009iio.1, mouse [Q3UHK6-4]
uc009iip.1, mouse [Q3UHK6-3]
uc009iiq.1, mouse [Q3UHK6-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF059485 mRNA Translation: AAC31807.1
AB025413 mRNA Translation: BAA77399.1
AK147579 mRNA Translation: BAE28005.1
AK147329 mRNA Translation: BAE27851.1
AK162046 mRNA Translation: BAE36695.1
AK122490 mRNA Translation: BAC65772.1
CCDSiCCDS40024.1 [Q3UHK6-4]
CCDS80753.1 [Q3UHK6-3]
CCDS80754.1 [Q3UHK6-2]
PIRiT14271
RefSeqiNP_001297689.1, NM_001310760.1 [Q3UHK6-3]
NP_001297691.1, NM_001310762.1 [Q3UHK6-2]
NP_035988.2, NM_011858.4 [Q3UHK6-4]
XP_017177717.1, XM_017322228.1

3D structure databases

SMRiQ3UHK6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi204827, 2 interactors
IntActiQ3UHK6, 1 interactor
STRINGi10090.ENSMUSP00000102783

PTM databases

GlyConnecti2432, 3 N-Linked glycans (4 sites) [Q3UHK6-2]
GlyGeniQ3UHK6, 12 sites
iPTMnetiQ3UHK6
PhosphoSitePlusiQ3UHK6
SwissPalmiQ3UHK6

Proteomic databases

jPOSTiQ3UHK6
MaxQBiQ3UHK6
PaxDbiQ3UHK6
PeptideAtlasiQ3UHK6
PRIDEiQ3UHK6

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
67208, 24 antibodies

Genome annotation databases

EnsembliENSMUST00000107162; ENSMUSP00000102780; ENSMUSG00000048078 [Q3UHK6-2]
ENSMUST00000107165; ENSMUSP00000102783; ENSMUSG00000048078 [Q3UHK6-3]
ENSMUST00000107166; ENSMUSP00000102784; ENSMUSG00000048078 [Q3UHK6-4]
GeneIDi23966
KEGGimmu:23966
UCSCiuc009iio.1, mouse [Q3UHK6-4]
uc009iip.1, mouse [Q3UHK6-3]
uc009iiq.1, mouse [Q3UHK6-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26011
MGIiMGI:2447063, Tenm4

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG4659, Eukaryota
GeneTreeiENSGT01000000214453
HOGENOMiCLU_000229_0_0_1
InParanoidiQ3UHK6
OMAiIAGMDTH
PhylomeDBiQ3UHK6
TreeFamiTF316833

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23966, 0 hits in 13 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Tenm4, mouse

Protein Ontology

More...
PROi
PR:Q3UHK6
RNActiQ3UHK6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000048078, Expressed in cumulus cell and 263 other tissues
GenevisibleiQ3UHK6, MM

Family and domain databases

Gene3Di2.120.10.30, 2 hits
InterProiView protein in InterPro
IPR011042, 6-blade_b-propeller_TolB-like
IPR008969, CarboxyPept-like_regulatory
IPR000742, EGF-like_dom
IPR013111, EGF_extracell
IPR022385, Rhs_assc_core
IPR031325, RHS_repeat
IPR027691, Ten-4
IPR009471, Ten_N
IPR028916, Tox-GHH_dom
IPR006530, YD
PANTHERiPTHR11219:SF9, PTHR11219:SF9, 1 hit
PfamiView protein in Pfam
PF07974, EGF_2, 1 hit
PF05593, RHS_repeat, 1 hit
PF06484, Ten_N, 2 hits
PF15636, Tox-GHH, 1 hit
SMARTiView protein in SMART
SM00181, EGF, 8 hits
SUPFAMiSSF49464, SSF49464, 1 hit
TIGRFAMsiTIGR03696, Rhs_assc_core, 1 hit
TIGR01643, YD_repeat_2x, 1 hit
PROSITEiView protein in PROSITE
PS00022, EGF_1, 8 hits
PS01186, EGF_2, 7 hits
PS50026, EGF_3, 5 hits
PS51361, TENEURIN_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTEN4_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UHK6
Secondary accession number(s): O70465
, Q3TSI0, Q3UH52, Q80TF5, Q9WTS7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: October 7, 2020
This is version 127 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again