Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucoside xylosyltransferase 1

Gene

Gxylt1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.By similarity

Catalytic activityi

UDP-alpha-D-xylose + beta-D-glucosyl-R = UDP + alpha-D-xylose-(1->3)-beta-D-glucosyl-R.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGlycosyltransferase, Transferase

Protein family/group databases

CAZyiGT8 Glycosyltransferase Family 8

Names & Taxonomyi

Protein namesi
Recommended name:
Glucoside xylosyltransferase 1 (EC:2.4.2.n2)
Alternative name(s):
Glycosyltransferase 8 domain-containing protein 3
Gene namesi
Name:Gxylt1
Synonyms:Glt8d3, Gm87
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2684933 Gxylt1

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 6CytoplasmicSequence analysis6
Transmembranei7 – 29Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini30 – 404LumenalSequence analysisAdd BLAST375

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002885351 – 404Glucoside xylosyltransferase 1Add BLAST404

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi201N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ3UHH8
PaxDbiQ3UHH8
PRIDEiQ3UHH8

PTM databases

iPTMnetiQ3UHH8
PhosphoSitePlusiQ3UHH8
SwissPalmiQ3UHH8

Expressioni

Gene expression databases

BgeeiENSMUSG00000036197 Expressed in 221 organ(s), highest expression level in blastocyst
CleanExiMM_GLT8D3
ExpressionAtlasiQ3UHH8 baseline and differential
GenevisibleiQ3UHH8 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000047281

Structurei

3D structure databases

ProteinModelPortaliQ3UHH8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 8 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3765 Eukaryota
ENOG410XRNY LUCA
GeneTreeiENSGT00510000046589
HOGENOMiHOG000264229
HOVERGENiHBG059879
InParanoidiQ3UHH8
KOiK13676
PhylomeDBiQ3UHH8
TreeFamiTF323210

Family and domain databases

Gene3Di3.90.550.10, 1 hit
InterProiView protein in InterPro
IPR002495 Glyco_trans_8
IPR029044 Nucleotide-diphossugar_trans
PfamiView protein in Pfam
PF01501 Glyco_transf_8, 1 hit
SUPFAMiSSF53448 SSF53448, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3UHH8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRYLRVVGL CLACGFCSLL YAFSQLAVSL EEGAAGGRRP QAAVVSWLAD
60 70 80 90 100
GGRGTGRGAG SAGPGRTGRY DMKTRPDEKM HLAVVACGER LEETVTMLKS
110 120 130 140 150
ALIFSIKPLH VHIFAEDQLH DSFKDRLASW SFLRRFDYSL YPITFPGDSA
160 170 180 190 200
ADWKKLFKPC ASQRLFLPLI LKEVDSLLYV DTDILFLRPV DDIWSLLKKF
210 220 230 240 250
NSTQIAAMAP EHEEPRIGWY NRFARHPYYG RTGVNSGVML MNMTRMRRKY
260 270 280 290 300
FKNDMTTARL QWGDILMPLL KKYKLNITWG DQDLLNIVFS HNPESLFVFP
310 320 330 340 350
CQWNYRPDHC IYGSNCREAE EEGVFILHGN RGVYHDDKQP AFRAVYEALR
360 370 380 390 400
NCSLEDDSVR SLLKPLELEL QKTVHTYCGK TYKIFIKQLT KSIRNRYDTP

PKER
Length:404
Mass (Da):46,491
Last modified:May 29, 2007 - v2
Checksum:iA0D1C1B9A2B6ADBC
GO
Isoform 2 (identifier: Q3UHH8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-404: SLEDDSVRSLLKPLELELQKTVHTYCGKTYKIFIKQLTKSIRNRYDTPPKER → WCLTASAVSLRGFRGWSGTD

Note: No experimental confirmation available.
Show »
Length:372
Mass (Da):42,480
Checksum:i9D54A960225F4CA4
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z6W7D3Z6W7_MOUSE
Glucoside xylosyltransferase 1
Gxylt1
435Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_025710353 – 404SLEDD…PPKER → WCLTASAVSLRGFRGWSGTD in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147387 mRNA Translation: BAE27879.1
AC127360 Genomic DNA No translation available.
CH466550 Genomic DNA Translation: EDL04286.1
BC141302 mRNA Translation: AAI41303.1
BC171972 mRNA Translation: AAI71972.1
CCDSiCCDS27764.1 [Q3UHH8-2]
RefSeqiNP_001028447.1, NM_001033275.4 [Q3UHH8-2]
XP_006520912.1, XM_006520849.1
UniGeneiMm.22819

Genome annotation databases

EnsembliENSMUST00000049484; ENSMUSP00000047281; ENSMUSG00000036197 [Q3UHH8-2]
ENSMUST00000230063; ENSMUSP00000155854; ENSMUSG00000036197 [Q3UHH8-1]
GeneIDi223827
KEGGimmu:223827
UCSCiuc007xiq.1 mouse [Q3UHH8-2]
uc011zyf.1 mouse [Q3UHH8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147387 mRNA Translation: BAE27879.1
AC127360 Genomic DNA No translation available.
CH466550 Genomic DNA Translation: EDL04286.1
BC141302 mRNA Translation: AAI41303.1
BC171972 mRNA Translation: AAI71972.1
CCDSiCCDS27764.1 [Q3UHH8-2]
RefSeqiNP_001028447.1, NM_001033275.4 [Q3UHH8-2]
XP_006520912.1, XM_006520849.1
UniGeneiMm.22819

3D structure databases

ProteinModelPortaliQ3UHH8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000047281

Protein family/group databases

CAZyiGT8 Glycosyltransferase Family 8

PTM databases

iPTMnetiQ3UHH8
PhosphoSitePlusiQ3UHH8
SwissPalmiQ3UHH8

Proteomic databases

MaxQBiQ3UHH8
PaxDbiQ3UHH8
PRIDEiQ3UHH8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000049484; ENSMUSP00000047281; ENSMUSG00000036197 [Q3UHH8-2]
ENSMUST00000230063; ENSMUSP00000155854; ENSMUSG00000036197 [Q3UHH8-1]
GeneIDi223827
KEGGimmu:223827
UCSCiuc007xiq.1 mouse [Q3UHH8-2]
uc011zyf.1 mouse [Q3UHH8-1]

Organism-specific databases

CTDi283464
MGIiMGI:2684933 Gxylt1

Phylogenomic databases

eggNOGiKOG3765 Eukaryota
ENOG410XRNY LUCA
GeneTreeiENSGT00510000046589
HOGENOMiHOG000264229
HOVERGENiHBG059879
InParanoidiQ3UHH8
KOiK13676
PhylomeDBiQ3UHH8
TreeFamiTF323210

Miscellaneous databases

PROiPR:Q3UHH8
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036197 Expressed in 221 organ(s), highest expression level in blastocyst
CleanExiMM_GLT8D3
ExpressionAtlasiQ3UHH8 baseline and differential
GenevisibleiQ3UHH8 MM

Family and domain databases

Gene3Di3.90.550.10, 1 hit
InterProiView protein in InterPro
IPR002495 Glyco_trans_8
IPR029044 Nucleotide-diphossugar_trans
PfamiView protein in Pfam
PF01501 Glyco_transf_8, 1 hit
SUPFAMiSSF53448 SSF53448, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGXLT1_MOUSE
AccessioniPrimary (citable) accession number: Q3UHH8
Secondary accession number(s): B7ZWC3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: September 12, 2018
This is version 91 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again