Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM and calponin homology domains-containing protein 1

Gene

Limch1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Actin stress fibers-associated protein that activates non-muscle myosin IIa. Activates the non-muscle myosin IIa complex by promoting the phosphorylation of its regulatory subunit MRLC/MYL9. Through the activation of non-muscle myosin IIa, positively regulates actin stress fibers assembly and stabilizes focal adhesions. It therefore negatively regulates cell spreading and cell migration.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
LIM and calponin homology domains-containing protein 1Curated
Gene namesi
Name:Limch1Imported
Synonyms:Kiaa1102Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1924819 Limch1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002936201 – 1057LIM and calponin homology domains-containing protein 1Add BLAST1057

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei169PhosphoserineCombined sources1
Modified residuei177PhosphoserineCombined sources1
Modified residuei192PhosphoserineBy similarity1
Modified residuei201PhosphoserineCombined sources1
Modified residuei204PhosphoserineCombined sources1
Modified residuei207PhosphoserineCombined sources1
Modified residuei215PhosphothreonineCombined sources1
Modified residuei217PhosphoserineCombined sources1
Modified residuei226PhosphoserineCombined sources1
Modified residuei231PhosphoserineCombined sources1
Modified residuei233PhosphoserineCombined sources1
Modified residuei297PhosphoserineBy similarity1
Modified residuei303PhosphoserineBy similarity1
Modified residuei313PhosphotyrosineCombined sources1
Modified residuei377PhosphoserineBy similarity1
Modified residuei402PhosphothreonineBy similarity1
Modified residuei471PhosphoserineCombined sources1
Modified residuei472PhosphothreonineCombined sources1
Modified residuei518PhosphoserineBy similarity1
Modified residuei523PhosphoserineBy similarity1
Modified residuei529PhosphothreonineBy similarity1
Modified residuei537PhosphothreonineBy similarity1
Modified residuei603PhosphoserineBy similarity1
Modified residuei672PhosphoserineCombined sources1
Modified residuei719PhosphoserineCombined sources1
Modified residuei725PhosphothreonineBy similarity1
Modified residuei751PhosphoserineCombined sources1
Modified residuei757PhosphoserineCombined sources1
Modified residuei760PhosphoserineCombined sources1
Modified residuei899PhosphothreonineCombined sources1
Modified residuei973PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ3UH68
PaxDbiQ3UH68
PeptideAtlasiQ3UH68
PRIDEiQ3UH68

PTM databases

iPTMnetiQ3UH68
PhosphoSitePlusiQ3UH68

Expressioni

Gene expression databases

BgeeiENSMUSG00000037736 Expressed in 275 organ(s), highest expression level in lung
CleanExiMM_LIMCH1
ExpressionAtlasiQ3UH68 baseline and differential
GenevisibleiQ3UH68 MM

Interactioni

Subunit structurei

Interacts with MYH9; independently of the integration of MYH9 into the myosin complex.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi218768, 3 interactors
IntActiQ3UH68, 2 interactors
STRINGi10090.ENSMUSP00000098723

Structurei

3D structure databases

ProteinModelPortaliQ3UH68
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini21 – 128Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST108
Domaini985 – 1051LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST67

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni251 – 641Mediates interaction with MYH9By similarityAdd BLAST391

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili354 – 439Sequence analysisAdd BLAST86
Coiled coili782 – 823Sequence analysisAdd BLAST42

Sequence similaritiesi

Belongs to the LIMCH1 family.Curated

Keywords - Domaini

Coiled coil, LIM domain

Phylogenomic databases

eggNOGiENOG410INGH Eukaryota
ENOG4111HMN LUCA
GeneTreeiENSGT00530000063559
HOGENOMiHOG000113325
HOVERGENiHBG108087
InParanoidiQ3UH68
OMAiNDCYIRS
TreeFamiTF332155

Family and domain databases

CDDicd00014 CH, 1 hit
Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR001997 Calponin/LIMCH1
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR031865 DUF4757
IPR029980 LIMCH1
IPR001781 Znf_LIM
PANTHERiPTHR15551:SF3 PTHR15551:SF3, 1 hit
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF15949 DUF4757, 1 hit
PF00412 LIM, 1 hit
PRINTSiPR00889 CALPONIN
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00132 LIM, 1 hit
SUPFAMiSSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3UH68-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MACPALGLEV LQPLQPEPPP EPAFAEAQKW IEQVTGRSFG DKDFRTGLEN
60 70 80 90 100
GILLCELLNA IKPGLVKKIN RLPTPIAGLD NTILFLRGCK ELGLKESQLF
110 120 130 140 150
DPSDLQDTSN RVTVKNLDYS RKLKNVLVTI YWLGKAANSC ASYGGTTLNL
160 170 180 190 200
KEFEGLLAQM RKETDDIDSP KRSIRDSGYI DCWDSERSDS LSPPRHGRDD
210 220 230 240 250
SFDSLDSFGS RSRQTPSPDV VLRGSSDGRG SDSESDLPHR KLPDVKKDDM
260 270 280 290 300
SARRTSHGEP KSAVPFNQYL PNKSNQTAYV PAPLRKKKAE REEFRKSWST
310 320 330 340 350
ATSPLGGERP FRYGPRTPVS DDAESTSMFD MRCEEEAAVL PHSRARQEQL
360 370 380 390 400
QLINNQLREE DDKWQDDLAR WKSRRRSASQ DLIKKEEERK KMEKLMSGED
410 420 430 440 450
GTSERRKSIK TYREIVQEKE RRERELHEAY KNARSQEEAE GILQQYIERF
460 470 480 490 500
TISEAVLERL EMPKILERSH STEPNVSSFP NDPSPMKYLR QQSLPPPKFT
510 520 530 540 550
ATVETTIART SVPESIASAG TGSPSKIITP NTVPMLTPRP YSQPKNSQEV
560 570 580 590 600
LKTFKVDGKV SMNGEMAPGD EEGKEKEGPA AAAPGPSLTK SQMFEGVATV
610 620 630 640 650
HDSPVQVKQG SNSIEINIKK PNSAPQELTA ASEETESNGQ EDEDGEERPG
660 670 680 690 700
TGDLEPDSAE PQHFTTTVTR CSPTVALVEF SSNPQLKNEV PEQGQKKPED
710 720 730 740 750
EMSGKVELVL SQKVAKPKSP EPEATLTFPF LDKMPETNQL HLPNPSSQAD
760 770 780 790 800
SPSSEKSPGS TPFKFWAWDP EEERRRQEKW QQEQERLLQE RYQKEQDKLK
810 820 830 840 850
EEWEKAQKEV EEEERRYYEE ERKIIEDTVV PFTISSSSAD QLSTSLSVTE
860 870 880 890 900
GSGTRNKMDL ENCPDKENER RQKTPFQEND GDSLLKTREG GLPEEQSLTP
910 920 930 940 950
SPSANPEISV SKGIHQDPQL EAEAGAPHCG TNPQPAQDPP RNQQIPNPPT
960 970 980 990 1000
STSEDVKPKT LALEKTINHQ MESPGERRKS ISGKKLCSSC GLTLGKGAAM
1010 1020 1030 1040 1050
IIETLNLYFH IQCFRCGICK GQLGDAVSGT DVRIRNGLLN CTDCYMRSRS

AGQPTTL
Length:1,057
Mass (Da):118,196
Last modified:July 10, 2007 - v2
Checksum:i3989AAF7718E320C
GO
Isoform 2 (identifier: Q3UH68-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-156: Missing.
     157-162: LAQMRK → MDPERQ

Show »
Length:901
Mass (Da):101,084
Checksum:i02969E988DC348D5
GO
Isoform 3 (identifier: Q3UH68-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MACPALGLEVLQP → MHKTCTIRSFIRDFYRILFTCARPSIMSDDAESTSMFDMRCEEEAAVLPHSRARQEQ
     199-398: Missing.

Note: No experimental confirmation available.
Show »
Length:901
Mass (Da):100,675
Checksum:i06BB440AE76ACA4F
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YU22D3YU22_MOUSE
LIM and calponin homology domains-c...
Limch1
1,068Annotation score:
D3Z589D3Z589_MOUSE
LIM and calponin homology domains-c...
Limch1
898Annotation score:
D3YU59D3YU59_MOUSE
LIM and calponin homology domains-c...
Limch1
774Annotation score:
D6RHT2D6RHT2_MOUSE
LIM and calponin homology domains-c...
Limch1
83Annotation score:
D3YV55D3YV55_MOUSE
LIM and calponin homology domains-c...
Limch1
237Annotation score:
F6X3N8F6X3N8_MOUSE
LIM and calponin homology domains-c...
Limch1
268Annotation score:
F6W1Y9F6W1Y9_MOUSE
LIM and calponin homology domains-c...
Limch1
60Annotation score:
A0A0J9YUH0A0A0J9YUH0_MOUSE
LIM and calponin homology domains-c...
Limch1
29Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti682S → P in AAH75634 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0265511 – 156Missing in isoform 2. 1 PublicationAdd BLAST156
Alternative sequenceiVSP_0265521 – 13MACPA…EVLQP → MHKTCTIRSFIRDFYRILFT CARPSIMSDDAESTSMFDMR CEEEAAVLPHSRARQEQ in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_026553157 – 162LAQMRK → MDPERQ in isoform 2. 1 Publication6
Alternative sequenceiVSP_026554199 – 398Missing in isoform 3. 1 PublicationAdd BLAST200

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK134095 mRNA Translation: BAE22010.1
AK147547 mRNA Translation: BAE27989.1
AC119834 Genomic DNA No translation available.
AC152416 Genomic DNA No translation available.
AC158994 Genomic DNA No translation available.
BC075634 mRNA Translation: AAH75634.1
AK122443 mRNA Translation: BAC65725.1
CCDSiCCDS39102.1 [Q3UH68-1]
CCDS57347.1 [Q3UH68-2]
RefSeqiNP_001001980.2, NM_001001980.2 [Q3UH68-1]
NP_001243051.1, NM_001256122.1 [Q3UH68-2]
UniGeneiMm.374778

Genome annotation databases

EnsembliENSMUST00000038188; ENSMUSP00000043163; ENSMUSG00000037736 [Q3UH68-2]
ENSMUST00000101164; ENSMUSP00000098723; ENSMUSG00000037736 [Q3UH68-1]
GeneIDi77569
KEGGimmu:77569
UCSCiuc008xph.1 mouse [Q3UH68-1]
uc008xpj.1 mouse [Q3UH68-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK134095 mRNA Translation: BAE22010.1
AK147547 mRNA Translation: BAE27989.1
AC119834 Genomic DNA No translation available.
AC152416 Genomic DNA No translation available.
AC158994 Genomic DNA No translation available.
BC075634 mRNA Translation: AAH75634.1
AK122443 mRNA Translation: BAC65725.1
CCDSiCCDS39102.1 [Q3UH68-1]
CCDS57347.1 [Q3UH68-2]
RefSeqiNP_001001980.2, NM_001001980.2 [Q3UH68-1]
NP_001243051.1, NM_001256122.1 [Q3UH68-2]
UniGeneiMm.374778

3D structure databases

ProteinModelPortaliQ3UH68
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi218768, 3 interactors
IntActiQ3UH68, 2 interactors
STRINGi10090.ENSMUSP00000098723

PTM databases

iPTMnetiQ3UH68
PhosphoSitePlusiQ3UH68

Proteomic databases

MaxQBiQ3UH68
PaxDbiQ3UH68
PeptideAtlasiQ3UH68
PRIDEiQ3UH68

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000038188; ENSMUSP00000043163; ENSMUSG00000037736 [Q3UH68-2]
ENSMUST00000101164; ENSMUSP00000098723; ENSMUSG00000037736 [Q3UH68-1]
GeneIDi77569
KEGGimmu:77569
UCSCiuc008xph.1 mouse [Q3UH68-1]
uc008xpj.1 mouse [Q3UH68-2]

Organism-specific databases

CTDi22998
MGIiMGI:1924819 Limch1
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410INGH Eukaryota
ENOG4111HMN LUCA
GeneTreeiENSGT00530000063559
HOGENOMiHOG000113325
HOVERGENiHBG108087
InParanoidiQ3UH68
OMAiNDCYIRS
TreeFamiTF332155

Miscellaneous databases

ChiTaRSiLimch1 mouse
PROiPR:Q3UH68
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037736 Expressed in 275 organ(s), highest expression level in lung
CleanExiMM_LIMCH1
ExpressionAtlasiQ3UH68 baseline and differential
GenevisibleiQ3UH68 MM

Family and domain databases

CDDicd00014 CH, 1 hit
Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR001997 Calponin/LIMCH1
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR031865 DUF4757
IPR029980 LIMCH1
IPR001781 Znf_LIM
PANTHERiPTHR15551:SF3 PTHR15551:SF3, 1 hit
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF15949 DUF4757, 1 hit
PF00412 LIM, 1 hit
PRINTSiPR00889 CALPONIN
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00132 LIM, 1 hit
SUPFAMiSSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLIMC1_MOUSE
AccessioniPrimary (citable) accession number: Q3UH68
Secondary accession number(s): Q6DIC3, Q80TK1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: November 7, 2018
This is version 110 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again