Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (16 Oct 2019)
Sequence version 2 (10 Jul 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ras-responsive element-binding protein 1

Gene

Rreb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1 (By similarity). Binds specifically to the allelic variant of the CDKN2A promoter present in Balb/c mice, which leads to a down-regulation of CDKN2A expression in this strain, and, as a consequence, to an elevated susceptibility to pristane-induced tumors.By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri66 – 88C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri206 – 228C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri233 – 256C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri314 – 336C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri641 – 663C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri669 – 691C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri697 – 720C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri751 – 782C2H2-type 10PROSITE-ProRule annotationAdd BLAST32
Zinc fingeri788 – 813C2H2-type 11PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1251 – 1273C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1400 – 1422C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1520 – 1542C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1548 – 1570C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-responsive element-binding protein 1
Short name:
RREB-1
Alternative name(s):
RAS-responsive zinc finger transcription factor RREB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rreb1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443664 Rreb1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002951551 – 1700Ras-responsive element-binding protein 1Add BLAST1700

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei36PhosphoserineBy similarity1
Modified residuei42PhosphoserineBy similarity1
Modified residuei161PhosphoserineCombined sources1
Modified residuei175PhosphoserineBy similarity1
Modified residuei180PhosphoserineBy similarity1
Modified residuei229PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki433Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki500Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki549Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki564Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki591Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki611Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki613Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateBy similarity
Cross-linki613Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Cross-linki622Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki855Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki883Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki911Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei970PhosphoserineCombined sources1
Modified residuei1125PhosphoserineBy similarity1
Modified residuei1137PhosphoserineCombined sources1
Modified residuei1138PhosphoserineCombined sources1
Modified residuei1172PhosphoserineBy similarity1
Modified residuei1179PhosphoserineCombined sources1
Modified residuei1180PhosphoserineCombined sources1
Modified residuei1230PhosphoserineBy similarity1
Modified residuei1450PhosphoserineCombined sources1
Modified residuei1452PhosphoserineCombined sources1
Modified residuei1593PhosphoserineCombined sources1
Modified residuei1606PhosphoserineCombined sources1
Modified residuei1667PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q3UH06

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3UH06

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3UH06

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3UH06

PeptideAtlas

More...
PeptideAtlasi
Q3UH06

PRoteomics IDEntifications database

More...
PRIDEi
Q3UH06

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3UH06

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3UH06

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q3UH06

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in splenic B-cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000039087 Expressed in 300 organ(s), highest expression level in skin of back

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3UH06 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3UH06 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NEUROD1 and AR.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
213031, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000105867

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3UH06

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi479 – 542Pro-richAdd BLAST64
Compositional biasi921 – 925Poly-Ser5
Compositional biasi1320 – 1325Poly-Ala6
Compositional biasi1328 – 1359Glu-richAdd BLAST32

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri66 – 88C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri206 – 228C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri233 – 256C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri314 – 336C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri641 – 663C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri669 – 691C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri697 – 720C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri751 – 782C2H2-type 10PROSITE-ProRule annotationAdd BLAST32
Zinc fingeri788 – 813C2H2-type 11PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1251 – 1273C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1400 – 1422C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1520 – 1542C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1548 – 1570C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157533

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154195

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3UH06

KEGG Orthology (KO)

More...
KOi
K20210

Identification of Orthologs from Complete Genome Data

More...
OMAi
IPKNFRR

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3UH06

TreeFam database of animal gene trees

More...
TreeFami
TF332503

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 15 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 8 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3UH06-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSNSPIGLE GSDLSSINTM MSAVMSVASV TENGGSPQGI KSPMKPPGPN
60 70 80 90 100
RIGRRNQETK EEKSSYNCPL CEKICTTQHQ LTMHIRQHNT DTGGADHACS
110 120 130 140 150
ICGKSLSSAS SLDRHMLVHS GERPYKCTVC GQSFTTNGNM HRHMKIHEKD
160 170 180 190 200
TNSTTAAAPP SPLKRRRLSS KRKLSHDAES EDPGPAKKMV EDGQSGDLDK
210 220 230 240 250
MSDEIFHCPV CFKEFVCKYE LETHMETHSD NPLRCDICCV TFRTHRGLLR
260 270 280 290 300
HNALVHKQLP RDAMGRPFIQ NNPSIPAGFH DLGFTDFSCR KFPRISQAWC
310 320 330 340 350
ETNLRRCISE QHRFVCDTCD KAFPMLSSLI LHRQSHIPAD QGREKLQTKT
360 370 380 390 400
LAAESLEQKA FLALLGLQHT KDVKPAPAEE LLPDDNQAIQ LQTLKYQLPQ
410 420 430 440 450
EPGCPTVLSV SPLDAASLGG SLTVLPATKE NMKHLSLQPF QKGFIIQPDS
460 470 480 490 500
SIVVKPISGE SAIELADIQQ ILKMAASAPP QISLPPLSKA PATPLQAIFK
510 520 530 540 550
HMPPLKPKPL VTPRTVVAAS TPPPLINAQQ ASPGCISPSL PPQSLKFLKG
560 570 580 590 600
SVEAVSNVHL LQSKSGIQPS TTTQLFLQQA GVELPGQPEM KTQLEQESII
610 620 630 640 650
EALLPLNMEA KIKQEITEGD LKAIMTGPSG KKTPAMRKVL YPCRFCNQVF
660 670 680 690 700
AFSGVLRAHV RSHLGISPYQ CNICDYIAAD KAALIRHIRT HSGERPYICK
710 720 730 740 750
ICHYPFTVKA NCERHLRKKH LKATRKDIEK NIEYVSSPTA ELVDAFCAPE
760 770 780 790 800
TVCRLCGEDL KHYRALRIHM RTHCSRGLGG CHKGRKPFEC KECNAPFVAK
810 820 830 840 850
RNCIHHILKQ HLHVPEKDIE SYVLATNSGL GPADTPTDAA SRGEEGSCVT
860 870 880 890 900
FAECKPLATF LEPQNGFLHS SPTQPLPSHI SVKLEPASSF AMDFNEPLDF
910 920 930 940 950
SQKGLALVQV KQENVSSLLT SSSSSALYDC SMEPIDLSIP KSVKKGDKDT
960 970 980 990 1000
VVPSDAKKPE PEAGQAEPLS PRPPPCPTLS VTVEPKGSLE TPTGTVVAVT
1010 1020 1030 1040 1050
TAAKLEPHTQ PLQGSVQLAV PIYSPALVSN TPLLGNSAAL LNNPALLRPL
1060 1070 1080 1090 1100
RPKPPLLLPK PSMTEELPPL ASIAQIISSV SSAPTLLKTK VADPGPSITS
1110 1120 1130 1140 1150
SNTVATDSPG SSIPKAAATP TDTTSSKESS EPPPAASSPE EALPTEQGPA
1160 1170 1180 1190 1200
ATSSSRKRGR KRGLRNRPLP NSSAVDLDSS GEFASIEKML ATTDTNKFSP
1210 1220 1230 1240 1250
FLQTAEDDTQ EEVAGAPADQ HGPADEEQGS PAEDRLLRAK RNSYANCLQK
1260 1270 1280 1290 1300
INCPHCPRVF PWASSLQRHM LTHTDSQSDT DTLTTPGEVL DLTAQAKEQP
1310 1320 1330 1340 1350
PAEGASEISP ASQDLAIKEA KAAAAPSEEE EEKETEENPE PEEECRVEES
1360 1370 1380 1390 1400
TGAADAPEED TASNQSLDLD FATKLMDFKL AESEAGSVDS QGPAQQEPKH
1410 1420 1430 1440 1450
ACDTCGKNFK FLGTLSRHKK AHSCQEPKEE EAAAPSLENE GVGRAVEGPS
1460 1470 1480 1490 1500
PSPEPEEKPA ESLAIDPTPG TREASVAKQN EETEGPTDGE GTAEKRGDGD
1510 1520 1530 1540 1550
KRPKTDSPKS MASKADKRKK VCSVCNKRFW SLQDLTRHMR SHTGERPYKC
1560 1570 1580 1590 1600
QTCERTFTLK HSLVRHQRIH QKARHSKHHG KDSDKDERAE EDSEDESTHS
1610 1620 1630 1640 1650
ATNPASENEA ESAPSTSNHV AVTRSRKESL STSGKECSPE ERAAAEQAAE
1660 1670 1680 1690 1700
PSAPKEQASP GETDPQSPAA IVQDLLELCG KRPAPILAAT DGASQLLGME
Length:1,700
Mass (Da):184,154
Last modified:July 10, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDAB9246A566B1BC9
GO
Isoform 2 (identifier: Q3UH06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-82: Missing.

Show »
Length:1,618
Mass (Da):175,402
Checksum:i52678CF395D69693
GO
Isoform 3 (identifier: Q3UH06-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1274-1274: T → TGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTTCSLRRNGLIPPKESDVGSHDST

Show »
Length:1,754
Mass (Da):190,167
Checksum:iEE5F35416BEC03BC
GO
Isoform 4 (identifier: Q3UH06-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1275-1291: DSQSDTDTLTTPGEVLD → GKKALTAHQAVSLERKE
     1292-1700: Missing.

Show »
Length:1,291
Mass (Da):140,184
Checksum:i8AAF680E466B62B7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6UB40F6UB40_MOUSE
Ras-responsive element-binding prot...
Rreb1
320Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q3UHQ4Q3UHQ4_MOUSE
Ras-responsive element-binding prot...
Rreb1
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8JJE4B8JJE4_MOUSE
Ras-responsive element-binding prot...
Rreb1
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8JJE5B8JJE5_MOUSE
Ras-responsive element-binding prot...
Rreb1
12Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti834D → G in BAE28051 (PubMed:16141072).Curated1
Sequence conflicti1113I → T in AAH80680 (Ref. 4) Curated1
Sequence conflicti1178D → G in BAE28051 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0267651 – 82Missing in isoform 2. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_0267661274T → TGQKPFPCQKCDAFFSTKSN CERHQLRKHGVTTCSLRRNG LIPPKESDVGSHDST in isoform 3. 1 Publication1
Alternative sequenceiVSP_0267671275 – 1291DSQSD…GEVLD → GKKALTAHQAVSLERKE in isoform 4. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_0267681292 – 1700Missing in isoform 4. 2 PublicationsAdd BLAST409

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK147653 mRNA Translation: BAE28051.1
AK154980 mRNA Translation: BAE32969.1
AK171375 mRNA Translation: BAE42417.1
CT010477 Genomic DNA No translation available.
BC080680 mRNA Translation: AAH80680.1
AY946044 mRNA Translation: AAX83010.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36634.1 [Q3UH06-4]
CCDS49238.1 [Q3UH06-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001034277.1, NM_001039188.1 [Q3UH06-4]
NP_001171339.1, NM_001177868.1 [Q3UH06-4]
NP_001171340.1, NM_001177869.1 [Q3UH06-3]
NP_081106.1, NM_026830.2 [Q3UH06-4]
XP_006516812.1, XM_006516749.1 [Q3UH06-3]
XP_006516813.1, XM_006516750.2 [Q3UH06-3]
XP_006516814.1, XM_006516751.2 [Q3UH06-3]
XP_006516815.1, XM_006516752.2 [Q3UH06-3]
XP_006516816.1, XM_006516753.3 [Q3UH06-3]
XP_006516817.1, XM_006516754.3 [Q3UH06-3]
XP_006516819.1, XM_006516756.2 [Q3UH06-3]
XP_006516820.1, XM_006516757.3 [Q3UH06-3]
XP_006516822.1, XM_006516759.1 [Q3UH06-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000037232; ENSMUSP00000049265; ENSMUSG00000039087 [Q3UH06-3]
ENSMUST00000110237; ENSMUSP00000105866; ENSMUSG00000039087 [Q3UH06-4]
ENSMUST00000110238; ENSMUSP00000105867; ENSMUSG00000039087 [Q3UH06-4]
ENSMUST00000128570; ENSMUSP00000115599; ENSMUSG00000039087 [Q3UH06-3]
ENSMUST00000149745; ENSMUSP00000121211; ENSMUSG00000039087 [Q3UH06-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
68750

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:68750

UCSC genome browser

More...
UCSCi
uc007qcw.2 mouse [Q3UH06-4]
uc007qda.2 mouse [Q3UH06-1]
uc007qdb.2 mouse [Q3UH06-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147653 mRNA Translation: BAE28051.1
AK154980 mRNA Translation: BAE32969.1
AK171375 mRNA Translation: BAE42417.1
CT010477 Genomic DNA No translation available.
BC080680 mRNA Translation: AAH80680.1
AY946044 mRNA Translation: AAX83010.1
CCDSiCCDS36634.1 [Q3UH06-4]
CCDS49238.1 [Q3UH06-3]
RefSeqiNP_001034277.1, NM_001039188.1 [Q3UH06-4]
NP_001171339.1, NM_001177868.1 [Q3UH06-4]
NP_001171340.1, NM_001177869.1 [Q3UH06-3]
NP_081106.1, NM_026830.2 [Q3UH06-4]
XP_006516812.1, XM_006516749.1 [Q3UH06-3]
XP_006516813.1, XM_006516750.2 [Q3UH06-3]
XP_006516814.1, XM_006516751.2 [Q3UH06-3]
XP_006516815.1, XM_006516752.2 [Q3UH06-3]
XP_006516816.1, XM_006516753.3 [Q3UH06-3]
XP_006516817.1, XM_006516754.3 [Q3UH06-3]
XP_006516819.1, XM_006516756.2 [Q3UH06-3]
XP_006516820.1, XM_006516757.3 [Q3UH06-3]
XP_006516822.1, XM_006516759.1 [Q3UH06-1]

3D structure databases

SMRiQ3UH06
ModBaseiSearch...

Protein-protein interaction databases

BioGridi213031, 4 interactors
STRINGi10090.ENSMUSP00000105867

PTM databases

iPTMnetiQ3UH06
PhosphoSitePlusiQ3UH06
SwissPalmiQ3UH06

Proteomic databases

EPDiQ3UH06
jPOSTiQ3UH06
MaxQBiQ3UH06
PaxDbiQ3UH06
PeptideAtlasiQ3UH06
PRIDEiQ3UH06

Genome annotation databases

EnsembliENSMUST00000037232; ENSMUSP00000049265; ENSMUSG00000039087 [Q3UH06-3]
ENSMUST00000110237; ENSMUSP00000105866; ENSMUSG00000039087 [Q3UH06-4]
ENSMUST00000110238; ENSMUSP00000105867; ENSMUSG00000039087 [Q3UH06-4]
ENSMUST00000128570; ENSMUSP00000115599; ENSMUSG00000039087 [Q3UH06-3]
ENSMUST00000149745; ENSMUSP00000121211; ENSMUSG00000039087 [Q3UH06-4]
GeneIDi68750
KEGGimmu:68750
UCSCiuc007qcw.2 mouse [Q3UH06-4]
uc007qda.2 mouse [Q3UH06-1]
uc007qdb.2 mouse [Q3UH06-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6239
MGIiMGI:2443664 Rreb1

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000157533
HOGENOMiHOG000154195
InParanoidiQ3UH06
KOiK20210
OMAiIPKNFRR
OrthoDBi1318335at2759
PhylomeDBiQ3UH06
TreeFamiTF332503

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Rreb1 mouse

Protein Ontology

More...
PROi
PR:Q3UH06

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000039087 Expressed in 300 organ(s), highest expression level in skin of back
ExpressionAtlasiQ3UH06 baseline and differential
GenevisibleiQ3UH06 MM

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 4 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 15 hits
SUPFAMiSSF57667 SSF57667, 8 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRREB1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3UH06
Secondary accession number(s): B8JJE2
, B8JJE3, Q3TB97, Q4ZE88, Q66JZ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: October 16, 2019
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again