Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase Nek10

Gene

Nek10

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.By similarity

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei548ATPPROSITE-ProRule annotationBy similarity1
Active sitei655Proton acceptorPROSITE-ProRule annotationBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi525 – 533ATPPROSITE-ProRule annotationBy similarity9

GO - Molecular functioni

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase Nek10 (EC:2.7.11.1)
Alternative name(s):
Never in mitosis A-related kinase 10
Short name:
NimA-related protein kinase 10
Gene namesi
Name:Nek10Imported
Synonyms:Gm282
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:2685128 Nek10

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002837941 – 1111Serine/threonine-protein kinase Nek10Add BLAST1111

Proteomic databases

PaxDbiQ3UGM2
PRIDEiQ3UGM2

PTM databases

PhosphoSitePlusiQ3UGM2

Expressioni

Gene expression databases

BgeeiENSMUSG00000042567 Expressed in 12 organ(s), highest expression level in testis
CleanExiMM_NEK10
ExpressionAtlasiQ3UGM2 baseline and differential

Interactioni

Protein-protein interaction databases

BioGridi586574, 2 interactors
STRINGi10090.ENSMUSP00000108249

Structurei

3D structure databases

ProteinModelPortaliQ3UGM2
SMRiQ3UGM2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini519 – 791Protein kinasePROSITE-ProRule annotationAdd BLAST273

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili481 – 514Sequence analysisAdd BLAST34

Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0589 Eukaryota
ENOG410Y7JF LUCA
GeneTreeiENSGT00910000144066
HOGENOMiHOG000113762
HOVERGENiHBG108180
InParanoidiQ3UGM2
KOiK20879
PhylomeDBiQ3UGM2

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008266 Tyr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00185 ARM, 4 hits
SUPFAMiSSF48371 SSF48371, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00109 PROTEIN_KINASE_TYR, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.iShow all

Isoform 1Curated (identifier: Q3UGM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPDQDTKAKS TEKTADKQQG TTTRDYSDLK RLRCLLNVQS SKQQLPAINF
60 70 80 90 100
DSAQNNMTKS EPTIRTGGHR ARGQWHESTE AVELENFSIN YKNERNFSKH
110 120 130 140 150
PQHQLFQEIF TALVRNRLIC REWVNRAPSI HFLRVLICLR LLMRDPCYQE
160 170 180 190 200
ILHKLGGIED LAQYMEIVAN EYLGYAEEQH CVDKLVNMTY IFQKLAAVKD
210 220 230 240 250
QREWVTASGA HKTLVSLLGA RDTTVLLGAL LALASLAESS ECREKISELN
260 270 280 290 300
VVENLLMILH EYDLLSKRLT AELLRLLCAE PQIKEQVKLY EGIPILLSLL
310 320 330 340 350
HSDHLKLLWS VIWILVQVCE DPETSVEIRI WGGIKQLLHI LQGDRNFVSD
360 370 380 390 400
RSSIGSLSSA NAAGRIQQLH LSEDLSPGEI EENTVSLQAA CCAALTELAL
410 420 430 440 450
NDTNAHQVVQ ENGVYTIAKL ILPNKQSNAA QTNLLQCYAF RTLRFLFSME
460 470 480 490 500
RNRPLFKRLF PTDLFETFID IGHYVRDIGA YKDLVSQLNL LLEDELKQIA
510 520 530 540 550
ENIESINQKK APLKYIGDYA VLDHLGSGAF GCVYKVRKRS GQNLLAMKEV
560 570 580 590 600
NLHNPAFGKD KKDRDSSVKN IVSELTIIKE QLYHPNVVRY YKTFLENDRL
610 620 630 640 650
YIVMELIEGA PLGEHFNSLK EKHHHFSEER LWKIFIQLCL ALRYLHKEKR
660 670 680 690 700
IVHRDLTPNN IMLGDKDKVT VTDFGLAKQK QESSKLTSMV GTILYSCPEV
710 720 730 740 750
LKSEPYGEKA DVWAAGCILY QMATLSPPFC STNMLSLATK IVEAVYEPVP
760 770 780 790 800
EGIYSEKVTD TIRRCLTPDA EARPDIVEVS SMISDVMMKY LDRLSTSQLA
810 820 830 840 850
LERKLERERR RTQRYFMEAN RNAVTCHHEL ALLSQETFEK ASLSSSSSGA
860 870 880 890 900
ASLKSELSES AELPGEGCHI PCGKEEDRVC EEVLSEDNFQ LESVEKDLYS
910 920 930 940 950
ELDDELDVSD NCSSSSSSPL KESTFSILKR SFSASGRERH SQARDFIAGL
960 970 980 990 1000
GSRPRPGPQM STFVVESASA GIAVSQRKVR QICDPIQQIL IQLHKVIYIT
1010 1020 1030 1040 1050
QLPPALHHDL KRRVIERFKK SLFSQQSNPC NLKSEIKKLS QGSPEPIELN
1060 1070 1080 1090 1100
FLTSDYHSLR HSRAANNWSP SDPTGSPSSF EVEEGVTYEQ MQTVIEEVLE
1110
ESGYYNFTTK R
Length:1,111
Mass (Da):126,058
Last modified:April 17, 2007 - v2
Checksum:iFBA45871F4EA2E98
GO
Isoform 21 Publication (identifier: Q3UGM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-603: Missing.
     957-1007: GPQMSTFVVESASAGIAVSQRKVRQICDPIQQILIQLHKVIYITQLPPALH → ALLPLHLLGKVPHQCPGTT

Note: No experimental confirmation available.Curated
Show »
Length:476
Mass (Da):53,683
Checksum:i77B8B728D9EC6B4F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K3W4R8K3W4R8_MOUSE
Serine/threonine-protein kinase Nek...
Nek10
1,115Annotation score:
F6XT14F6XT14_MOUSE
Serine/threonine-protein kinase Nek...
Nek10
279Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0523521 – 603Missing in isoform 2. 1 PublicationAdd BLAST603
Alternative sequenceiVSP_052353957 – 1007GPQMS…PPALH → ALLPLHLLGKVPHQCPGTT in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK147862 mRNA Translation: BAE28185.1
AC129580 Genomic DNA No translation available.
RefSeqiNP_001182158.1, NM_001195229.1
UniGeneiMm.317563

Genome annotation databases

EnsembliENSMUST00000112631; ENSMUSP00000108250; ENSMUSG00000042567 [Q3UGM2-1]
GeneIDi674895
KEGGimmu:674895
UCSCiuc007sgs.2 mouse [Q3UGM2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNEK10_MOUSE
AccessioniPrimary (citable) accession number: Q3UGM2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: September 12, 2018
This is version 105 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again