Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 114 (17 Jun 2020)
Sequence version 2 (03 Apr 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Histone-lysine N-methyltransferase KMT5B

Gene

Kmt5b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone methyltransferase that specifically methylates monomethylated 'Lys-20' (H4K20me1) and dimethylated 'Lys-20' (H4K20me2) of histone H4 to produce respectively dimethylated 'Lys-20' (H4K20me2) and trimethylated 'Lys-20' (H4K20me3) and thus regulates transcription and maintenance of genome integrity (PubMed:28114273, PubMed:24049080, PubMed:15145825). In vitro also methylates unmodified 'Lys-20' (H4K20me0) of histone H4 and nucleosomes (By similarity). H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression (PubMed:15145825). Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions (PubMed:15145825). KMT5B is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2) (PubMed:16612004, PubMed:15750587). Plays a role in myogenesis by regulating the expression of target genes, such as EID3 (PubMed:23720823). Facilitates TP53BP1 foci formation upon DNA damage and proficient non-homologous end-joining (NHEJ)-directed DNA repair by catalyzing the di- and trimethylation of 'Lys-20' of histone H4 (By similarity). May play a role in class switch reconbination by catalyzing the di- and trimethylation of 'Lys-20' of histone H4 (PubMed:28114273).By similarity6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by 6,7-Dichloro-N-cyclopentyl-4-(pyridin-4-yl)phthalazin-1-amine (A-196). A-196 is competitive with the histone peptide substrate H4K20me1 but non competitive with S-adenosyl-L-methionine.By similarity

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=46 µM for histone H4K20me1 peptide1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei99S-adenosyl-L-methionineCombined sources1 Publication1
    Binding sitei211S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygenCombined sources1 Publication1
    Binding sitei258S-adenosyl-L-methionineCombined sources1 Publication1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi276ZincCombined sources1 Publication1
    Metal bindingi320ZincCombined sources1 Publication1
    Binding sitei321S-adenosyl-L-methionine; via amide nitrogenCombined sources1 Publication1
    Metal bindingi322ZincCombined sources1 Publication1
    Metal bindingi325ZincCombined sources1 Publication1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionChromatin regulator, Methyltransferase, Repressor, Transferase
    Biological processMyogenesis, Transcription, Transcription regulation
    LigandMetal-binding, S-adenosyl-L-methionine, Zinc

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-MMU-3214841 PKMTs methylate histone lysines

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Histone-lysine N-methyltransferase KMT5BCurated
    Alternative name(s):
    Lysine-specific methyltransferase 5BBy similarity
    Suppressor of variegation 4-20 homolog 1
    Short name:
    Su(var)4-20 homolog 1
    Short name:
    Suv4-20h1
    [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5BCurated (EC:2.1.1.3623 Publications)
    [histone H4]-lysine20 N-methyltransferase KMT5BCurated (EC:2.1.1.361By similarity)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:Kmt5bImported
    Synonyms:Suv420h1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

    Organism-specific databases

    Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

    More...
    MGIi
    MGI:2444557 Kmt5b

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Chromosome, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

    Partial muscle-specific knockout mice display several signs of muscular dystrophy including necrosis and an increased number of centrally nucleated myofibers. RNAi-mediated knockdown in C2C12 muscle cells causes reduced myogenic differentiation of the cells.1 Publication

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi282F → Y: Loss of methyltransferase activity for H4K20me1 peptide. 1 Publication1

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002817881 – 883Histone-lysine N-methyltransferase KMT5BAdd BLAST883

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki556Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

    Keywords - PTMi

    Isopeptide bond, Ubl conjugation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q3U8K7

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q3U8K7

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q3U8K7

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q3U8K7

    PeptideAtlas

    More...
    PeptideAtlasi
    Q3U8K7

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q3U8K7

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q3U8K7

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q3U8K7

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSMUSG00000045098 Expressed in dorsal pancreas and 272 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q3U8K7 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q3U8K7 MM

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homodimer (PubMed:24049080).

    Interacts with HP1 proteins CBX1, CBX3 and CBX5 (PubMed:15145825).

    Interacts with RB1 family proteins RB1, RBL1 and RBL2 (PubMed:15750587, PubMed:16612004).

    Interacts (via C-terminus) with FRG1 (PubMed:23720823).

    5 Publications

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...
    BioGRIDi
    230441, 3 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    10090.ENSMUSP00000109605

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    Q3U8K7 protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1883
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q3U8K7

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    Protein Data Bank in Europe - Knowledge Base

    More...
    PDBe-KBi
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini194 – 309SETPROSITE-ProRule annotationAdd BLAST116

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni204 – 207S-adenosyl-L-methionine bindingCombined sources1 Publication4
    Regioni273 – 274S-adenosyl-L-methionine bindingCombined sources1 Publication2

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG2589 Eukaryota
    ENOG410XPH8 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000156431

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    CLU_328991_0_0_1

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q3U8K7

    KEGG Orthology (KO)

    More...
    KOi
    K11429

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    TKLQHAG

    Database of Orthologous Groups

    More...
    OrthoDBi
    236983at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q3U8K7

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF106433

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    1.10.10.1700, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR041938 Hist-Lys_N-MTase_N
    IPR025790 Hist-Lys_N-MTase_Suvar4-20
    IPR039977 KMT5B/KMT5C/SET9
    IPR001214 SET_dom

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR12977 PTHR12977, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00856 SET, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00317 SET, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS51570 SAM_MT43_SUVAR420_2, 1 hit
    PS50280 SET, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q3U8K7-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MKWLGDSKNM VVNGRRNGGK LSNDHQQNQS KLQQHSGKDT LKTGRNAVER
    60 70 80 90 100
    RSSRCHGNSG FEGQSRYVPS SGMSAKELCE NDDLATSLVL DPYLGFQTHK
    110 120 130 140 150
    MNTSAFPSRS SRHISKADSF SHNNPVRFRP IKGRQEELKE VIERFKKDEH
    160 170 180 190 200
    LEKAFKCLTS GEWARHYFLN KNKMQEKLFK EHVFIYLRMF ATDSGFEILP
    210 220 230 240 250
    CNRYSSEQNG AKIVATKEWK RNDKIELLVG CIAELSEIEE NMLLRHGEND
    260 270 280 290 300
    FSVMYSTRKN CAQLWLGPAA FINHDCRPNC KFVSTGRDTA CVKALRDIEP
    310 320 330 340 350
    GEEISCYYGD GFFGENNEFC ECYTCERRGT GAFKSRVGLP APAPVINSKY
    360 370 380 390 400
    GLRETDKRLN RLKKLGDSSK NSDSQSVSSN TDADTTQEKD NATSNRKSSV
    410 420 430 440 450
    GVKKSSKSRA LTRPSMPRVP AASNSTSPKL VHTNNPRVPK KLRKPAKPLL
    460 470 480 490 500
    SKIRLRNHCK RLDQKSASRK LEMGSLVLKE PKVVLYKNLP IKKEREPEGP
    510 520 530 540 550
    AHAAVGSGCL TRHAAREHRQ NHGRGAHSQG DSLPCTYTTR RSLRTRTGLK
    560 570 580 590 600
    ETTDIKLEPS PLDGYKNGIL EPCPDSGQQP TPEVLEELAP ETAHREEASQ
    610 620 630 640 650
    ECPKNDSCLS RKKFRQVKPV KHLAKTEDCS PEHSFPGKDG LPDLPGSHPD
    660 670 680 690 700
    QGEPSGTVRV PVSHTDSAPS PVGCSVVAPD SFTKDSFRTA QSKKKRRVTR
    710 720 730 740 750
    YDAQLILENS SGIPKLTLRR RHDSSSKTND HESDGVNSSK ISIKLSKDHD
    760 770 780 790 800
    SDSNLYVAKL SNGVSAGPGS SSTKLKIQLK RDEESRGPCA EGLHENGVCC
    810 820 830 840 850
    SDPLSLLESQ MEVDDYSQYE EDSTDESSSS EGEEEEEDCE DDFDDDFIPL
    860 870 880
    PPAKRLRLIV GKDSIDIDIS SRRREDQSLR LNA
    Length:883
    Mass (Da):98,580
    Last modified:April 3, 2007 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2B24461F582CC5F1
    GO
    Isoform 2 (identifier: Q3U8K7-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         393-394: TS → SK
         395-883: Missing.

    Show »
    Length:394
    Mass (Da):44,723
    Checksum:i1425ECDBE1F767D7
    GO
    Isoform 3 (identifier: Q3U8K7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         104-126: Missing.

    Show »
    Length:860
    Mass (Da):96,070
    Checksum:i2EEE457CEE91A890
    GO
    Isoform 4 (identifier: Q3U8K7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         328-883: Missing.

    Show »
    Length:327
    Mass (Da):37,546
    Checksum:i6400D6AAEEA26B99
    GO
    Isoform 5 (identifier: Q3U8K7-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         104-126: Missing.
         831-883: EGEEEEEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA → SGKAAEANCW

    Show »
    Length:817
    Mass (Da):90,944
    Checksum:i478C772F2EAFDEC4
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    H3BLE5H3BLE5_MOUSE
    Histone-lysine N-methyltransferase ...
    Kmt5b
    423Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H3BJI9H3BJI9_MOUSE
    Histone-lysine N-methyltransferase ...
    Kmt5b
    93Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H3BJ94H3BJ94_MOUSE
    Histone-lysine N-methyltransferase ...
    Kmt5b
    87Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H3BKZ5H3BKZ5_MOUSE
    Histone-lysine N-methyltransferase ...
    Kmt5b
    110Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    D3YXL6D3YXL6_MOUSE
    Histone-lysine N-methyltransferase ...
    Kmt5b
    212Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A494B976A0A494B976_MOUSE
    Histone-lysine N-methyltransferase ...
    Kmt5b
    85Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAH11214 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence AAT00539 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence BAC39834 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence BAE23934 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53S → N in AAH75709 (PubMed:15489334).Curated1
    Sequence conflicti153K → E in AAH11214 (PubMed:16141072).Curated1
    Sequence conflicti292V → L in BAC39834 (PubMed:15145825).Curated1
    Sequence conflicti328R → Q in BAE31010 (PubMed:16141072).Curated1
    Sequence conflicti428P → A in AAH75709 (PubMed:15489334).Curated1
    Sequence conflicti472E → G in BAC38817 (PubMed:15145825).Curated1
    Sequence conflicti521N → S in AAH75709 (PubMed:15489334).Curated1
    Sequence conflicti590P → H in BAC38817 (PubMed:15145825).Curated1
    Sequence conflicti595R → G in BAE31010 (PubMed:16141072).Curated1
    Sequence conflicti664H → Y in AAH75709 (PubMed:15489334).Curated1
    Sequence conflicti678A → T in AAH75709 (PubMed:15489334).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024053104 – 126Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST23
    Alternative sequenceiVSP_024054328 – 883Missing in isoform 4. 2 PublicationsAdd BLAST556
    Alternative sequenceiVSP_024055393 – 394TS → SK in isoform 2. 1 Publication2
    Alternative sequenceiVSP_024056395 – 883Missing in isoform 2. 1 PublicationAdd BLAST489
    Alternative sequenceiVSP_024057831 – 883EGEEE…LRLNA → SGKAAEANCW in isoform 5. 1 PublicationAdd BLAST53

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AY555192 mRNA Translation: AAT00539.1 Different initiation.
    AK036880 mRNA Translation: BAC29617.1
    AK054093 mRNA Translation: BAC35652.1
    AK082660 mRNA Translation: BAC38565.1
    AK083227 mRNA Translation: BAC38817.1
    AK087267 mRNA Translation: BAC39834.1 Different initiation.
    AK139255 mRNA Translation: BAE23934.1 Sequence problems.
    AK152179 mRNA Translation: BAE31010.1
    BC011214 mRNA Translation: AAH11214.1 Different initiation.
    BC075709 mRNA Translation: AAH75709.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS29399.1 [Q3U8K7-3]
    CCDS50343.1 [Q3U8K7-1]
    CCDS50344.1 [Q3U8K7-2]
    CCDS50345.1 [Q3U8K7-4]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001161356.1, NM_001167884.1 [Q3U8K7-4]
    NP_001161357.1, NM_001167885.1 [Q3U8K7-1]
    NP_001161358.1, NM_001167886.1 [Q3U8K7-3]
    NP_001161359.1, NM_001167887.1 [Q3U8K7-1]
    NP_001161360.1, NM_001167888.1 [Q3U8K7-4]
    NP_001161361.1, NM_001167889.1 [Q3U8K7-2]
    NP_659120.3, NM_144871.4 [Q3U8K7-3]
    XP_006531790.1, XM_006531727.3 [Q3U8K7-1]
    XP_006531791.1, XM_006531728.3 [Q3U8K7-1]
    XP_006531794.1, XM_006531731.2 [Q3U8K7-5]
    XP_011246925.1, XM_011248623.2 [Q3U8K7-1]
    XP_011246926.1, XM_011248624.2 [Q3U8K7-3]
    XP_017173632.1, XM_017318143.1 [Q3U8K7-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENSMUST00000005518; ENSMUSP00000005518; ENSMUSG00000045098 [Q3U8K7-4]
    ENSMUST00000052699; ENSMUSP00000060162; ENSMUSG00000045098 [Q3U8K7-2]
    ENSMUST00000113968; ENSMUSP00000109601; ENSMUSG00000045098 [Q3U8K7-4]
    ENSMUST00000113970; ENSMUSP00000109603; ENSMUSG00000045098 [Q3U8K7-2]
    ENSMUST00000113972; ENSMUSP00000109605; ENSMUSG00000045098 [Q3U8K7-1]
    ENSMUST00000113973; ENSMUSP00000109606; ENSMUSG00000045098 [Q3U8K7-1]
    ENSMUST00000113974; ENSMUSP00000109607; ENSMUSG00000045098 [Q3U8K7-3]
    ENSMUST00000113977; ENSMUSP00000109610; ENSMUSG00000045098 [Q3U8K7-3]
    ENSMUST00000176262; ENSMUSP00000135563; ENSMUSG00000045098 [Q3U8K7-3]
    ENSMUST00000237440; ENSMUSP00000158061; ENSMUSG00000045098 [Q3U8K7-4]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    225888

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    mmu:225888

    UCSC genome browser

    More...
    UCSCi
    uc008fww.2 mouse [Q3U8K7-4]
    uc008fwz.2 mouse [Q3U8K7-2]
    uc008fxa.2 mouse [Q3U8K7-1]
    uc008fxc.2 mouse [Q3U8K7-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AY555192 mRNA Translation: AAT00539.1 Different initiation.
    AK036880 mRNA Translation: BAC29617.1
    AK054093 mRNA Translation: BAC35652.1
    AK082660 mRNA Translation: BAC38565.1
    AK083227 mRNA Translation: BAC38817.1
    AK087267 mRNA Translation: BAC39834.1 Different initiation.
    AK139255 mRNA Translation: BAE23934.1 Sequence problems.
    AK152179 mRNA Translation: BAE31010.1
    BC011214 mRNA Translation: AAH11214.1 Different initiation.
    BC075709 mRNA Translation: AAH75709.1
    CCDSiCCDS29399.1 [Q3U8K7-3]
    CCDS50343.1 [Q3U8K7-1]
    CCDS50344.1 [Q3U8K7-2]
    CCDS50345.1 [Q3U8K7-4]
    RefSeqiNP_001161356.1, NM_001167884.1 [Q3U8K7-4]
    NP_001161357.1, NM_001167885.1 [Q3U8K7-1]
    NP_001161358.1, NM_001167886.1 [Q3U8K7-3]
    NP_001161359.1, NM_001167887.1 [Q3U8K7-1]
    NP_001161360.1, NM_001167888.1 [Q3U8K7-4]
    NP_001161361.1, NM_001167889.1 [Q3U8K7-2]
    NP_659120.3, NM_144871.4 [Q3U8K7-3]
    XP_006531790.1, XM_006531727.3 [Q3U8K7-1]
    XP_006531791.1, XM_006531728.3 [Q3U8K7-1]
    XP_006531794.1, XM_006531731.2 [Q3U8K7-5]
    XP_011246925.1, XM_011248623.2 [Q3U8K7-1]
    XP_011246926.1, XM_011248624.2 [Q3U8K7-3]
    XP_017173632.1, XM_017318143.1 [Q3U8K7-1]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    4BUPX-ray2.17A/B70-336[»]
    SMRiQ3U8K7
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi230441, 3 interactors
    STRINGi10090.ENSMUSP00000109605

    PTM databases

    iPTMnetiQ3U8K7
    PhosphoSitePlusiQ3U8K7

    Proteomic databases

    EPDiQ3U8K7
    jPOSTiQ3U8K7
    MaxQBiQ3U8K7
    PaxDbiQ3U8K7
    PeptideAtlasiQ3U8K7
    PRIDEiQ3U8K7

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...
    Antibodypediai
    30535 246 antibodies

    The DNASU plasmid repository

    More...
    DNASUi
    225888

    Genome annotation databases

    EnsembliENSMUST00000005518; ENSMUSP00000005518; ENSMUSG00000045098 [Q3U8K7-4]
    ENSMUST00000052699; ENSMUSP00000060162; ENSMUSG00000045098 [Q3U8K7-2]
    ENSMUST00000113968; ENSMUSP00000109601; ENSMUSG00000045098 [Q3U8K7-4]
    ENSMUST00000113970; ENSMUSP00000109603; ENSMUSG00000045098 [Q3U8K7-2]
    ENSMUST00000113972; ENSMUSP00000109605; ENSMUSG00000045098 [Q3U8K7-1]
    ENSMUST00000113973; ENSMUSP00000109606; ENSMUSG00000045098 [Q3U8K7-1]
    ENSMUST00000113974; ENSMUSP00000109607; ENSMUSG00000045098 [Q3U8K7-3]
    ENSMUST00000113977; ENSMUSP00000109610; ENSMUSG00000045098 [Q3U8K7-3]
    ENSMUST00000176262; ENSMUSP00000135563; ENSMUSG00000045098 [Q3U8K7-3]
    ENSMUST00000237440; ENSMUSP00000158061; ENSMUSG00000045098 [Q3U8K7-4]
    GeneIDi225888
    KEGGimmu:225888
    UCSCiuc008fww.2 mouse [Q3U8K7-4]
    uc008fwz.2 mouse [Q3U8K7-2]
    uc008fxa.2 mouse [Q3U8K7-1]
    uc008fxc.2 mouse [Q3U8K7-3]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    51111
    MGIiMGI:2444557 Kmt5b

    Phylogenomic databases

    eggNOGiKOG2589 Eukaryota
    ENOG410XPH8 LUCA
    GeneTreeiENSGT00940000156431
    HOGENOMiCLU_328991_0_0_1
    InParanoidiQ3U8K7
    KOiK11429
    OMAiTKLQHAG
    OrthoDBi236983at2759
    PhylomeDBiQ3U8K7
    TreeFamiTF106433

    Enzyme and pathway databases

    ReactomeiR-MMU-3214841 PKMTs methylate histone lysines

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...
    BioGRID-ORCSi
    225888 4 hits in 12 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    Suv420h1 mouse

    Protein Ontology

    More...
    PROi
    PR:Q3U8K7
    RNActiQ3U8K7 protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSMUSG00000045098 Expressed in dorsal pancreas and 272 other tissues
    ExpressionAtlasiQ3U8K7 baseline and differential
    GenevisibleiQ3U8K7 MM

    Family and domain databases

    Gene3Di1.10.10.1700, 1 hit
    InterProiView protein in InterPro
    IPR041938 Hist-Lys_N-MTase_N
    IPR025790 Hist-Lys_N-MTase_Suvar4-20
    IPR039977 KMT5B/KMT5C/SET9
    IPR001214 SET_dom
    PANTHERiPTHR12977 PTHR12977, 1 hit
    PfamiView protein in Pfam
    PF00856 SET, 1 hit
    SMARTiView protein in SMART
    SM00317 SET, 1 hit
    PROSITEiView protein in PROSITE
    PS51570 SAM_MT43_SUVAR420_2, 1 hit
    PS50280 SET, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKMT5B_MOUSE
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3U8K7
    Secondary accession number(s): Q3UTP6
    , Q6DI74, Q6Q784, Q8BU67, Q8BUN0, Q8BUT7, Q8BW73, Q8BZ24, Q91X81
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: April 3, 2007
    Last modified: June 17, 2020
    This is version 114 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families
    3. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again