Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 103 (08 May 2019)
Sequence version 1 (11 Oct 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Phosphoinositide 3-kinase regulatory subunit 6

Gene

Pik3r6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of the PI3K gamma complex. Acts as an adapter to drive activation of PIK3CG by beta-gamma G protein dimers. The PIK3CG:PIK3R6 heterodimer is much less sensitive to beta-gamma G proteins than PIK3CG:PIK3R5 and its membrane recruitment and beta-gamma G protein dimer-dependent activation requires HRAS bound to PIK3CG. Recruits of the PI3K gamma complex to a PDE3B:RAPGEF3 signaling complex involved in angiogenesis; signaling seems to involve RRAS.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAngiogenesis

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.137 3474

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-114604 GPVI-mediated activation cascade
R-MMU-1660499 Synthesis of PIPs at the plasma membrane
R-MMU-392451 G beta:gamma signalling through PI3Kgamma

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphoinositide 3-kinase regulatory subunit 6
Alternative name(s):
Phosphoinositide 3-kinase gamma adapter protein of 87 kDa
p84 PI3K adapter protein
Short name:
p84 PIKAP
p87 PI3K adapter protein
Short name:
p87PIKAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pik3r6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2144613 Pik3r6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002343391 – 756Phosphoinositide 3-kinase regulatory subunit 6Add BLAST756

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3U6Q4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3U6Q4

PRoteomics IDEntifications database

More...
PRIDEi
Q3U6Q4

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3U6Q4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3U6Q4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in heart. In a lower extent, also expressed in brain, spleen, lung, liver, kidney, prostate, thyroid, salivary gland, dendritic cells, macrophages and neutrophils.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000046207 Expressed in 108 organ(s), highest expression level in blastocyst

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3U6Q4 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of a catalytic subunit (PIK3CG) and a regulatory (PIK3R6) subunit. The binding of PIK3R6 to PIK3CG may exclude the binding of PIK3R5 to PIK3CG. Interacts with beta-gamma G protein dimers. Interacts with PDE3B; the interaction allows recruitment of the PI3K gamma complex to a PDE3B:RAPGEF3 complex.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q3U6Q4

Database of interacting proteins

More...
DIPi
DIP-60179N

Protein interaction database and analysis system

More...
IntActi
Q3U6Q4, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000099673

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410ITTQ Eukaryota
ENOG41103E9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063753

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000115540

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3U6Q4

KEGG Orthology (KO)

More...
KOi
K21290

Identification of Orthologs from Complete Genome Data

More...
OMAi
HYIIPLL

Database of Orthologous Groups

More...
OrthoDBi
171539at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3U6Q4

TreeFam database of animal gene trees

More...
TreeFami
TF102035

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019522 PIK3R5/6

The PANTHER Classification System

More...
PANTHERi
PTHR15593 PTHR15593, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10486 PI3K_1B_p101, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q3U6Q4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESSDVELDF QRSVQAVLRE LNTPNPALQS NQGMWRWSLH KKVERNPGKS
60 70 80 90 100
SILVRILLRE LEKAESEDGR RVIIPLLLTL MSVLTKATGI PEDLYHRAYT
110 120 130 140 150
FCTRLLTLPA PYSTVALDCA IRLKTETAVP GTLYQRTVIA EQNLISELYP
160 170 180 190 200
YQERVFLFVD PELVSASVCS ALLLEIQAAQ EQQTPEACMR HVVSHALQAA
210 220 230 240 250
LGEACHTGAL NRKLQASSRR VLEYYFHAVV AAIEQVASED SPSRLGHLEK
260 270 280 290 300
MEEIYCSLLG PATTRRHCVG DLLQDRLPSI PLPSPYITFH LWTDQEQLWK
310 320 330 340 350
ELVLFLRPRS QLRLSADLDA LDLQGFRLDR DLARVSTDSG IERDLPLGSD
360 370 380 390 400
ELPDPSSSEM ERAALQRKGG IKKRVWPPDF FMPGSWDGPP GLHRRTGRPS
410 420 430 440 450
GDGELLPGVS RVHTARVLVL GDDRMLGRLA QAYYRLRKRE TKKFCLTPRL
460 470 480 490 500
SLQLYYIPVL APQVTGQDPE ASRKPELGEL ASFLGRVDPW YESTVNTLCP
510 520 530 540 550
AILKLAEMPP YLDTSRTVDP FILDVITYYV RMGTQPIYFQ LYKVKIFTSL
560 570 580 590 600
SHDPTEDIFL TELKVKIQDS KSPKEGSSPR RRGAAEGTGA ELSMCYQKAL
610 620 630 640 650
LSHRPREVTV SLRATGLVLK AIPAGDTEVS GFFHCTSPNA ASATDCSCLH
660 670 680 690 700
VSVTEVVKSS NLAGRSFTTS TNTFRTSSIQ VQSQDQRLLT LWLDKDGRRT
710 720 730 740 750
FRDVVRFEVS PCPEPCSRTQ KSKTSALNSH GQETEKNMAK PNSLLMPINT

FSGIIQ
Length:756
Mass (Da):84,663
Last modified:October 11, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5F3B56982C514876
GO
Isoform 2 (identifier: Q3U6Q4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     463-466: Missing.

Show »
Length:752
Mass (Da):84,278
Checksum:i962135DD5874843C
GO
Isoform 3 (identifier: Q3U6Q4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-305: DLLQDRLPSIPLPSPYITFHLWTDQEQLWKELVLF → KRGPAGDLPRETAIRRGGRQRARLDRMRFPEEPED
     306-756: Missing.

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):34,315
Checksum:iE165638D90D34871
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti710S → G in BAE30180 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018255271 – 305DLLQD…ELVLF → KRGPAGDLPRETAIRRGGRQ RARLDRMRFPEEPED in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_018256306 – 756Missing in isoform 3. 1 PublicationAdd BLAST451
Alternative sequenceiVSP_018257463 – 466Missing in isoform 2. 2 Publications4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY753194 mRNA Translation: AAV30089.1
DQ295832 mRNA Translation: ABB97395.1
AK151178 mRNA Translation: BAE30180.1
AK153039 mRNA Translation: BAE31670.1
AK171063 mRNA Translation: BAE42222.1
BC028998 mRNA Translation: AAH28998.1
AL606831 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24866.1 [Q3U6Q4-2]
CCDS36186.1 [Q3U6Q4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001004435.1, NM_001004435.3 [Q3U6Q4-2]
NP_001075035.1, NM_001081566.2 [Q3U6Q4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000060441; ENSMUSP00000052522; ENSMUSG00000046207 [Q3U6Q4-1]
ENSMUST00000102613; ENSMUSP00000099673; ENSMUSG00000046207 [Q3U6Q4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
104709

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:104709

UCSC genome browser

More...
UCSCi
uc007jnq.1 mouse [Q3U6Q4-3]
uc007jnr.2 mouse [Q3U6Q4-1]
uc007jns.2 mouse [Q3U6Q4-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY753194 mRNA Translation: AAV30089.1
DQ295832 mRNA Translation: ABB97395.1
AK151178 mRNA Translation: BAE30180.1
AK153039 mRNA Translation: BAE31670.1
AK171063 mRNA Translation: BAE42222.1
BC028998 mRNA Translation: AAH28998.1
AL606831 Genomic DNA No translation available.
CCDSiCCDS24866.1 [Q3U6Q4-2]
CCDS36186.1 [Q3U6Q4-1]
RefSeqiNP_001004435.1, NM_001004435.3 [Q3U6Q4-2]
NP_001075035.1, NM_001081566.2 [Q3U6Q4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

CORUMiQ3U6Q4
DIPiDIP-60179N
IntActiQ3U6Q4, 4 interactors
STRINGi10090.ENSMUSP00000099673

PTM databases

iPTMnetiQ3U6Q4
PhosphoSitePlusiQ3U6Q4

Proteomic databases

MaxQBiQ3U6Q4
PaxDbiQ3U6Q4
PRIDEiQ3U6Q4

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000060441; ENSMUSP00000052522; ENSMUSG00000046207 [Q3U6Q4-1]
ENSMUST00000102613; ENSMUSP00000099673; ENSMUSG00000046207 [Q3U6Q4-2]
GeneIDi104709
KEGGimmu:104709
UCSCiuc007jnq.1 mouse [Q3U6Q4-3]
uc007jnr.2 mouse [Q3U6Q4-1]
uc007jns.2 mouse [Q3U6Q4-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
146850
MGIiMGI:2144613 Pik3r6

Phylogenomic databases

eggNOGiENOG410ITTQ Eukaryota
ENOG41103E9 LUCA
GeneTreeiENSGT00530000063753
HOGENOMiHOG000115540
InParanoidiQ3U6Q4
KOiK21290
OMAiHYIIPLL
OrthoDBi171539at2759
PhylomeDBiQ3U6Q4
TreeFamiTF102035

Enzyme and pathway databases

BRENDAi2.7.1.137 3474
ReactomeiR-MMU-114604 GPVI-mediated activation cascade
R-MMU-1660499 Synthesis of PIPs at the plasma membrane
R-MMU-392451 G beta:gamma signalling through PI3Kgamma

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q3U6Q4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000046207 Expressed in 108 organ(s), highest expression level in blastocyst
GenevisibleiQ3U6Q4 MM

Family and domain databases

InterProiView protein in InterPro
IPR019522 PIK3R5/6
PANTHERiPTHR15593 PTHR15593, 1 hit
PfamiView protein in Pfam
PF10486 PI3K_1B_p101, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPI3R6_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3U6Q4
Secondary accession number(s): Q3TBT5, Q3UAY4, Q8K323
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 11, 2005
Last modified: May 8, 2019
This is version 103 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again