Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 62

Gene

Wdr62

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for cerebral cortical development. Plays a role in neuronal proliferation and migration (By similarity). Plays a role in mother-centriole-dependent centriole duplication; the function seems also to involve CEP152, CDK5RAP2 and CEP63 through a stepwise assembled complex at the centrosome that recruits CDK2 required for centriole duplication (By similarity).By similarity

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 62
Gene namesi
Name:Wdr62
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1923696 Wdr62

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002818802 – 1523WD repeat-containing protein 62Add BLAST1522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei33PhosphoserineCombined sources1
Modified residuei46PhosphothreonineBy similarity1
Modified residuei501PhosphoserineBy similarity1
Modified residuei966PhosphoserineCombined sources1
Modified residuei972PhosphoserineCombined sources1
Modified residuei1072PhosphothreonineBy similarity1
Modified residuei1117PhosphoserineBy similarity1
Modified residuei1143PhosphoserineCombined sources1
Modified residuei1169PhosphoserineBy similarity1
Modified residuei1234PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ3U3T8
PaxDbiQ3U3T8
PRIDEiQ3U3T8

PTM databases

iPTMnetiQ3U3T8
PhosphoSitePlusiQ3U3T8

Expressioni

Tissue specificityi

Prominent in neural crest lineages from embryonic day (E) 9.5 to E11.5. Also expressed in the ventricular and subventricular zones during the period of cerebral cortical neurogenesis (E11.5-E16.5), with expression decreasing in intensity by E17.5 In the cerebellum, it is strongly expressed in precursors of granule neurons at late embryonic and early postnatal stages; by postnatal day 9 (P9). Present in fetal brain, enriched within the ventricular and subventricular zone (at protein level).1 Publication

Gene expression databases

CleanExiMM_WDR62

Interactioni

Subunit structurei

Can form homodimers (via C-terminus). Interacts (via C-terminus) with MAPKBP1 (via C-terminus). Interacts with CDK5RAP2, CEP152, CEP63 and KIAA0753. CEP63, CDK5RAP2, CEP152, WDR62 are proposed to form a stepwise assembled complex at the centrosome forming a ring near parental centrioles.By similarity

Protein-protein interaction databases

IntActiQ3U3T8, 2 interactors
STRINGi10090.ENSMUSP00000103825

Structurei

3D structure databases

ProteinModelPortaliQ3U3T8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati109 – 150WD 1Add BLAST42
Repeati153 – 194WD 2Add BLAST42
Repeati196 – 234WD 3Add BLAST39
Repeati291 – 330WD 4Add BLAST40
Repeati357 – 396WD 5Add BLAST40
Repeati411 – 450WD 6Add BLAST40
Repeati490 – 529WD 7Add BLAST40
Repeati532 – 574WD 8Add BLAST43
Repeati578 – 618WD 9Add BLAST41
Repeati626 – 665WD 10Add BLAST40
Repeati671 – 713WD 11Add BLAST43
Repeati714 – 752WD 12Add BLAST39
Repeati803 – 846WD 13Add BLAST44

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1408 Eukaryota
ENOG410Y87A LUCA
HOGENOMiHOG000010231
HOVERGENiHBG108669
InParanoidiQ3U3T8
PhylomeDBiQ3U3T8

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR024977 Apc4_WD40_dom
IPR011047 Quinoprotein_ADH-like_supfam
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
PfamiView protein in Pfam
PF12894 ANAPC4_WD40, 1 hit
PF00400 WD40, 3 hits
SMARTiView protein in SMART
SM00320 WD40, 12 hits
SUPFAMiSSF50998 SSF50998, 1 hit
PROSITEiView protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 3 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3U3T8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALAAGGYT RSDTIEKLSS VMAGVPARRN QSSPPPAPPL CLRRRTRLAA
60 70 80 90 100
APEDTVQNRV TLEKVLGITA QNSSGLTCDP GTGHVAYLAG CVVVVLNPKE
110 120 130 140 150
NKQQHIFNTT RKSLSALAFS PDGKYIVTGE NGHRPTVRIW DVEEKTQVAE
160 170 180 190 200
MLGHKYGVAC VAFSPNMKHI VSMGYQHDMV LNVWDWKKDI VVASNKVSCR
210 220 230 240 250
VIALSFSEDS SYFVTVGNRH VRFWFLEAST EAKVTSTVPL VGRSGILGEL
260 270 280 290 300
HNNIFCGVAC GRGRMAGNTF CVSYSGLLCQ FNEKRVLDKW INLKVSLSSC
310 320 330 340 350
LCVSDELIFC GCTDGIVRIF QAHSLLYLTN LPKPHYLGVD VAHGLDSSFL
360 370 380 390 400
FHRKAEAVYP DTVALTFDPV HQWLSCVYKD HSIYIWDVKD IDEVSKIWSE
410 420 430 440 450
LFHSSFVWNV EVYPEFEDQR ACLPSGTFLT CSSDNTIRFW NLDSASDTRW
460 470 480 490 500
QKNIFSDSLL KVVYVENDIQ HLQDLSHFPD RGSENGTPMD MKAGVRVMQV
510 520 530 540 550
SPDGQHLASG DRSGNLRIHE LHFMDELIKV EAHDAEVLCL EYSKPETGVT
560 570 580 590 600
LLASASRDRL IHVLNVEKNY NLEQTLDDHS SSITAIKFAG TRDVQMISCG
610 620 630 640 650
ADKSIYFRSA QQASDGLHFV RTHHVAEKTT LYDMDIDITQ KYVAVACQDR
660 670 680 690 700
NVRVYNTVSG KQKKCYKGSQ GDEGSLLKVH VDPSGTFLAT SCSDKSISLI
710 720 730 740 750
DFYSGECVAK MFGHSEIVTG MKFTYDCRHL ITVSGDSCVF IWHLGPEITT
760 770 780 790 800
CMKQHLLEIN HQEQQQQPKD QKWSGPPSQE TYASTPSEIR SLSPGEQTED
810 820 830 840 850
EMEEECEPEE LLKTPSKDSL DPDPRCLLTN GKLPLWAKRL LGDDDVADSS
860 870 880 890 900
AFHAKRSYQP HGRWAERAEQ EPLKTILDAW SLDSYFTPMK PENLQDSVLD
910 920 930 940 950
SVEPQNLAGL LSECSLGNGH TSPGEGLVSY LLHPELGSPK EDNRGHPSYL
960 970 980 990 1000
PLQREATEAS ELILCSPEAE VSLTGMHREY YEEETEAGPE DQQGDTYLRV
1010 1020 1030 1040 1050
SSVSSKDQSP PEDSGESEAE LECSFAAAHS SAPQTDPGPH LTMTAGKPEY
1060 1070 1080 1090 1100
PSTEELSQPE LPGLGNGSLP QTPEQEKFLR HHFETLTDAP TEELFHGSLG
1110 1120 1130 1140 1150
DIKISETEDY FFNPRLSIST QFLSRLQKTS RCPPRLPLHL MKSPEAQPVG
1160 1170 1180 1190 1200
QGGNQPKAGP LRAGTGYMSS DGTNVLSGQK AEETQEALSL LDRKPPTPTS
1210 1220 1230 1240 1250
VLTTGREQSI SAPSSCSYLE STTSSHAKTT RSISLGDSEG PVTAELPQSL
1260 1270 1280 1290 1300
HKPLSPGQEL QAIPTTVALT SSIKDHEPAP LSWGNHEARA SLKLTLSSVC
1310 1320 1330 1340 1350
EQLLSPPPQE PPITHVWSQE PVDVPPSMAV TVASFCAPSP VDMSTLGLHS
1360 1370 1380 1390 1400
SMFLPKTSAS GPLTPPAHLQ LLETRSRVPG STAALLEPTP DASGVIADSP
1410 1420 1430 1440 1450
GHWDTEVPTP ELLGSVESVL HRLQTAFQEA LDLYRMLVSS SQLGPEQQQA
1460 1470 1480 1490 1500
QTELASTFHW ILNQLEASNC MAAANLAPPQ TLPSPDPLSL PTLCPLASPN
1510 1520
LQALLEHYSE LLVQAVRRKA RGD
Length:1,523
Mass (Da):167,283
Last modified:April 3, 2007 - v2
Checksum:i28F92D7F102F9D08
GO
Isoform 2 (identifier: Q3U3T8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1046-1075: GKPEYPSTEELSQPELPGLGNGSLPQTPEQ → ASSAVTQSADKSSPPCLPSRVPKYRRAFPA
     1076-1523: Missing.

Note: No experimental confirmation available.
Show »
Length:1,075
Mass (Da):119,206
Checksum:i4D16DA6716F22770
GO
Isoform 3 (identifier: Q3U3T8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     913-934: Missing.
     1046-1048: Missing.

Note: No experimental confirmation available.
Show »
Length:1,498
Mass (Da):164,751
Checksum:i9B8970D049C58223
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QK36E9QK36_MOUSE
WD repeat-containing protein 62
Wdr62
1,524Annotation score:
E9PUI7E9PUI7_MOUSE
WD repeat-containing protein 62
Wdr62
1,076Annotation score:
F6R9F0F6R9F0_MOUSE
WD repeat-containing protein 62
Wdr62
1,053Annotation score:

Sequence cautioni

The sequence AAH57041 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE32697 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti136T → A in AAH54747 (PubMed:15489334).Curated1
Sequence conflicti647C → F in AAH57041 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024081913 – 934Missing in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_0240821046 – 1075GKPEY…QTPEQ → ASSAVTQSADKSSPPCLPSR VPKYRRAFPA in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_0240831046 – 1048Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_0240841076 – 1523Missing in isoform 2. 1 PublicationAdd BLAST448

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK154592 mRNA Translation: BAE32697.1 Different initiation.
BC054747 mRNA Translation: AAH54747.1
BC057041 mRNA Translation: AAH57041.1 Different initiation.
UniGeneiMm.271677

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK154592 mRNA Translation: BAE32697.1 Different initiation.
BC054747 mRNA Translation: AAH54747.1
BC057041 mRNA Translation: AAH57041.1 Different initiation.
UniGeneiMm.271677

3D structure databases

ProteinModelPortaliQ3U3T8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ3U3T8, 2 interactors
STRINGi10090.ENSMUSP00000103825

PTM databases

iPTMnetiQ3U3T8
PhosphoSitePlusiQ3U3T8

Proteomic databases

MaxQBiQ3U3T8
PaxDbiQ3U3T8
PRIDEiQ3U3T8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:1923696 Wdr62

Phylogenomic databases

eggNOGiKOG1408 Eukaryota
ENOG410Y87A LUCA
HOGENOMiHOG000010231
HOVERGENiHBG108669
InParanoidiQ3U3T8
PhylomeDBiQ3U3T8

Miscellaneous databases

ChiTaRSiWdr62 mouse
PROiPR:Q3U3T8
SOURCEiSearch...

Gene expression databases

CleanExiMM_WDR62

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR024977 Apc4_WD40_dom
IPR011047 Quinoprotein_ADH-like_supfam
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
PfamiView protein in Pfam
PF12894 ANAPC4_WD40, 1 hit
PF00400 WD40, 3 hits
SMARTiView protein in SMART
SM00320 WD40, 12 hits
SUPFAMiSSF50998 SSF50998, 1 hit
PROSITEiView protein in PROSITE
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiWDR62_MOUSE
AccessioniPrimary (citable) accession number: Q3U3T8
Secondary accession number(s): Q6PGG0, Q7TQE9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: November 7, 2018
This is version 97 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again