Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 105 (12 Aug 2020)
Sequence version 2 (03 Apr 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

WD repeat-containing protein 62

Gene

Wdr62

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for cerebral cortical development. Plays a role in neuronal proliferation and migration (By similarity). Plays a role in mother-centriole-dependent centriole duplication; the function seems also to involve CEP152, CDK5RAP2 and CEP63 through a stepwise assembled complex at the centrosome that recruits CDK2 required for centriole duplication (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WD repeat-containing protein 62
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Wdr62
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1923696, Wdr62

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002818802 – 1523WD repeat-containing protein 62Add BLAST1522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei33PhosphoserineCombined sources1
Modified residuei46PhosphothreonineBy similarity1
Modified residuei501PhosphoserineBy similarity1
Modified residuei966PhosphoserineCombined sources1
Modified residuei972PhosphoserineCombined sources1
Modified residuei1072PhosphothreonineBy similarity1
Modified residuei1117PhosphoserineBy similarity1
Modified residuei1143PhosphoserineCombined sources1
Modified residuei1169PhosphoserineBy similarity1
Modified residuei1234PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3U3T8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3U3T8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3U3T8

PRoteomics IDEntifications database

More...
PRIDEi
Q3U3T8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3U3T8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3U3T8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Prominent in neural crest lineages from embryonic day (E) 9.5 to E11.5. Also expressed in the ventricular and subventricular zones during the period of cerebral cortical neurogenesis (E11.5-E16.5), with expression decreasing in intensity by E17.5 In the cerebellum, it is strongly expressed in precursors of granule neurons at late embryonic and early postnatal stages; by postnatal day 9 (P9). Present in fetal brain, enriched within the ventricular and subventricular zone (at protein level).1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can form homodimers (via C-terminus).

Interacts (via C-terminus) with MAPKBP1 (via C-terminus).

Interacts with CDK5RAP2, CEP152, CEP63 and KIAA0753. CEP63, CDK5RAP2, CEP152, WDR62 are proposed to form a stepwise assembled complex at the centrosome forming a ring near parental centrioles.

By similarity

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q3U3T8, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000103825

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3U3T8, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati109 – 150WD 1Add BLAST42
Repeati153 – 194WD 2Add BLAST42
Repeati196 – 234WD 3Add BLAST39
Repeati291 – 330WD 4Add BLAST40
Repeati357 – 396WD 5Add BLAST40
Repeati411 – 450WD 6Add BLAST40
Repeati490 – 529WD 7Add BLAST40
Repeati532 – 574WD 8Add BLAST43
Repeati578 – 618WD 9Add BLAST41
Repeati626 – 665WD 10Add BLAST40
Repeati671 – 713WD 11Add BLAST43
Repeati714 – 752WD 12Add BLAST39
Repeati803 – 846WD 13Add BLAST44

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1408, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3U3T8

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3U3T8

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024977, Apc4_WD40_dom
IPR011047, Quinoprotein_ADH-like_supfam
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR017986, WD40_repeat_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12894, ANAPC4_WD40, 1 hit
PF00400, WD40, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320, WD40, 12 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50998, SSF50998, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50082, WD_REPEATS_2, 1 hit
PS50294, WD_REPEATS_REGION, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3U3T8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALAAGGYT RSDTIEKLSS VMAGVPARRN QSSPPPAPPL CLRRRTRLAA
60 70 80 90 100
APEDTVQNRV TLEKVLGITA QNSSGLTCDP GTGHVAYLAG CVVVVLNPKE
110 120 130 140 150
NKQQHIFNTT RKSLSALAFS PDGKYIVTGE NGHRPTVRIW DVEEKTQVAE
160 170 180 190 200
MLGHKYGVAC VAFSPNMKHI VSMGYQHDMV LNVWDWKKDI VVASNKVSCR
210 220 230 240 250
VIALSFSEDS SYFVTVGNRH VRFWFLEAST EAKVTSTVPL VGRSGILGEL
260 270 280 290 300
HNNIFCGVAC GRGRMAGNTF CVSYSGLLCQ FNEKRVLDKW INLKVSLSSC
310 320 330 340 350
LCVSDELIFC GCTDGIVRIF QAHSLLYLTN LPKPHYLGVD VAHGLDSSFL
360 370 380 390 400
FHRKAEAVYP DTVALTFDPV HQWLSCVYKD HSIYIWDVKD IDEVSKIWSE
410 420 430 440 450
LFHSSFVWNV EVYPEFEDQR ACLPSGTFLT CSSDNTIRFW NLDSASDTRW
460 470 480 490 500
QKNIFSDSLL KVVYVENDIQ HLQDLSHFPD RGSENGTPMD MKAGVRVMQV
510 520 530 540 550
SPDGQHLASG DRSGNLRIHE LHFMDELIKV EAHDAEVLCL EYSKPETGVT
560 570 580 590 600
LLASASRDRL IHVLNVEKNY NLEQTLDDHS SSITAIKFAG TRDVQMISCG
610 620 630 640 650
ADKSIYFRSA QQASDGLHFV RTHHVAEKTT LYDMDIDITQ KYVAVACQDR
660 670 680 690 700
NVRVYNTVSG KQKKCYKGSQ GDEGSLLKVH VDPSGTFLAT SCSDKSISLI
710 720 730 740 750
DFYSGECVAK MFGHSEIVTG MKFTYDCRHL ITVSGDSCVF IWHLGPEITT
760 770 780 790 800
CMKQHLLEIN HQEQQQQPKD QKWSGPPSQE TYASTPSEIR SLSPGEQTED
810 820 830 840 850
EMEEECEPEE LLKTPSKDSL DPDPRCLLTN GKLPLWAKRL LGDDDVADSS
860 870 880 890 900
AFHAKRSYQP HGRWAERAEQ EPLKTILDAW SLDSYFTPMK PENLQDSVLD
910 920 930 940 950
SVEPQNLAGL LSECSLGNGH TSPGEGLVSY LLHPELGSPK EDNRGHPSYL
960 970 980 990 1000
PLQREATEAS ELILCSPEAE VSLTGMHREY YEEETEAGPE DQQGDTYLRV
1010 1020 1030 1040 1050
SSVSSKDQSP PEDSGESEAE LECSFAAAHS SAPQTDPGPH LTMTAGKPEY
1060 1070 1080 1090 1100
PSTEELSQPE LPGLGNGSLP QTPEQEKFLR HHFETLTDAP TEELFHGSLG
1110 1120 1130 1140 1150
DIKISETEDY FFNPRLSIST QFLSRLQKTS RCPPRLPLHL MKSPEAQPVG
1160 1170 1180 1190 1200
QGGNQPKAGP LRAGTGYMSS DGTNVLSGQK AEETQEALSL LDRKPPTPTS
1210 1220 1230 1240 1250
VLTTGREQSI SAPSSCSYLE STTSSHAKTT RSISLGDSEG PVTAELPQSL
1260 1270 1280 1290 1300
HKPLSPGQEL QAIPTTVALT SSIKDHEPAP LSWGNHEARA SLKLTLSSVC
1310 1320 1330 1340 1350
EQLLSPPPQE PPITHVWSQE PVDVPPSMAV TVASFCAPSP VDMSTLGLHS
1360 1370 1380 1390 1400
SMFLPKTSAS GPLTPPAHLQ LLETRSRVPG STAALLEPTP DASGVIADSP
1410 1420 1430 1440 1450
GHWDTEVPTP ELLGSVESVL HRLQTAFQEA LDLYRMLVSS SQLGPEQQQA
1460 1470 1480 1490 1500
QTELASTFHW ILNQLEASNC MAAANLAPPQ TLPSPDPLSL PTLCPLASPN
1510 1520
LQALLEHYSE LLVQAVRRKA RGD
Length:1,523
Mass (Da):167,283
Last modified:April 3, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i28F92D7F102F9D08
GO
Isoform 2 (identifier: Q3U3T8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1046-1075: GKPEYPSTEELSQPELPGLGNGSLPQTPEQ → ASSAVTQSADKSSPPCLPSRVPKYRRAFPA
     1076-1523: Missing.

Show »
Length:1,075
Mass (Da):119,206
Checksum:i4D16DA6716F22770
GO
Isoform 3 (identifier: Q3U3T8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     913-934: Missing.
     1046-1048: Missing.

Show »
Length:1,498
Mass (Da):164,751
Checksum:i9B8970D049C58223
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QK36E9QK36_MOUSE
WD repeat-containing protein 62
Wdr62
1,524Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PUI7E9PUI7_MOUSE
WD repeat-containing protein 62
Wdr62
1,076Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6R9F0F6R9F0_MOUSE
WD repeat-containing protein 62
Wdr62
1,053Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH57041 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE32697 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti136T → A in AAH54747 (PubMed:15489334).Curated1
Sequence conflicti647C → F in AAH57041 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024081913 – 934Missing in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_0240821046 – 1075GKPEY…QTPEQ → ASSAVTQSADKSSPPCLPSR VPKYRRAFPA in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_0240831046 – 1048Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_0240841076 – 1523Missing in isoform 2. 1 PublicationAdd BLAST448

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK154592 mRNA Translation: BAE32697.1 Different initiation.
BC054747 mRNA Translation: AAH54747.1
BC057041 mRNA Translation: AAH57041.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS52178.1 [Q3U3T8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK154592 mRNA Translation: BAE32697.1 Different initiation.
BC054747 mRNA Translation: AAH54747.1
BC057041 mRNA Translation: AAH57041.1 Different initiation.
CCDSiCCDS52178.1 [Q3U3T8-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ3U3T8, 2 interactors
STRINGi10090.ENSMUSP00000103825

PTM databases

iPTMnetiQ3U3T8
PhosphoSitePlusiQ3U3T8

Proteomic databases

jPOSTiQ3U3T8
MaxQBiQ3U3T8
PaxDbiQ3U3T8
PRIDEiQ3U3T8

Organism-specific databases

MGIiMGI:1923696, Wdr62

Phylogenomic databases

eggNOGiKOG1408, Eukaryota
InParanoidiQ3U3T8
PhylomeDBiQ3U3T8

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Wdr62, mouse

Protein Ontology

More...
PROi
PR:Q3U3T8
RNActiQ3U3T8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR024977, Apc4_WD40_dom
IPR011047, Quinoprotein_ADH-like_supfam
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR017986, WD40_repeat_dom
PfamiView protein in Pfam
PF12894, ANAPC4_WD40, 1 hit
PF00400, WD40, 3 hits
SMARTiView protein in SMART
SM00320, WD40, 12 hits
SUPFAMiSSF50998, SSF50998, 1 hit
PROSITEiView protein in PROSITE
PS50082, WD_REPEATS_2, 1 hit
PS50294, WD_REPEATS_REGION, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWDR62_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3U3T8
Secondary accession number(s): Q6PGG0, Q7TQE9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: August 12, 2020
This is version 105 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again