Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 710

Gene

Znf710

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri297 – 319C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri325 – 347C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri465 – 487C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri493 – 515C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri521 – 543C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri549 – 571C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri577 – 600C2H2-type 11PROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 710
Gene namesi
Name:Znf710
Synonyms:Zfp710
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1921747 Zfp710

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002337091 – 666Zinc finger protein 710Add BLAST666

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki110Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki113Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki379Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ3U288
PaxDbiQ3U288
PeptideAtlasiQ3U288
PRIDEiQ3U288

PTM databases

iPTMnetiQ3U288
PhosphoSitePlusiQ3U288

Expressioni

Gene expression databases

BgeeiENSMUSG00000048897 Expressed in 201 organ(s), highest expression level in skeletal muscle tissue
CleanExiMM_ZFP710
ExpressionAtlasiQ3U288 baseline and differential
GenevisibleiQ3U288 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000050577

Structurei

3D structure databases

ProteinModelPortaliQ3U288
SMRiQ3U288
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi115 – 121Poly-Glu7
Compositional biasi176 – 233Pro-richAdd BLAST58

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri297 – 319C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri325 – 347C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri465 – 487C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri493 – 515C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri521 – 543C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri549 – 571C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri577 – 600C2H2-type 11PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00750000117653
HOVERGENiHBG066266
InParanoidiQ3U288
OMAiPEVYQLA
OrthoDBiEOG091G02N1
PhylomeDBiQ3U288
TreeFamiTF331510

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 9 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF57667 SSF57667, 6 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 11 hits
PS50157 ZINC_FINGER_C2H2_2, 11 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3U288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGFMDSGTQ TDAVVVLSLA QAAVLGLVSE NELFGATISA EAFYPDLGPE
60 70 80 90 100
LTGTAMGEPG PPGPDIYQLA CNGRALEEPP EEEVLEVEAA FEKHTRRKTR
110 120 130 140 150
PPVRLVPKVK FEKAEEEEEQ EVYEVSVPGD DKDPGPAEAP AEVASSGCEA
160 170 180 190 200
LVQSSAVKMI DLSAFSRKPR TLRHLPRTPR PELDMAPFDP PFPDPARDGF
210 220 230 240 250
PEPSMALPGP ETLPTECSFE PPHLAPLSNP EPPNMTSTTE LVKPEQGFVW
260 270 280 290 300
QESSEFEADT AGSTVERHKK AQLDRLDINV QIDDSYLVEA GDRQKRWQCR
310 320 330 340 350
MCEKSYTSKY NLVTHILGHN GIKPHSCPHC SKLFKQPSHL QTHLLTHQGT
360 370 380 390 400
RPHKCQVCHK AFTQTSHLKR HMLLHSEVKP YSCHFCGRGF AYPSELKAHE
410 420 430 440 450
VKHESGRCHV CVECGLDFST LTQLKRHLAS HQGPTLYQCL ECDKSFHYRS
460 470 480 490 500
QLQNHMLKHQ NVRPFVCTEC GMEFSQIHHL KQHSLTHKGV KEFKCEVCGR
510 520 530 540 550
EFTLQANMKR HMLIHTSVRP YQCHICFKTF VQKQTLKTHM IVHSPVKPFK
560 570 580 590 600
CKVCGKSFNR MYNLLGHMHL HAGSKPFKCP YCSSKFNLKG NLSRHMKVKH
610 620 630 640 650
GVMDISLDSQ DPMMELAGPD PSELDNHQEM EDFEENAYTY SSVDSSAEAS
660
TLTEQAMKEM AYYNVL
Length:666
Mass (Da):75,052
Last modified:October 11, 2005 - v1
Checksum:i726110C48EAD2054
GO
Isoform 2 (identifier: Q3U288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     611-666: DPMMELAGPD...MKEMAYYNVL → GGWAVRSGQS...EGEPGEPLWQ

Note: No experimental confirmation available.
Show »
Length:665
Mass (Da):74,620
Checksum:iE45CD9E0C856BE1F
GO
Isoform 3 (identifier: Q3U288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     611-666: DPMMELAGPD...MKEMAYYNVL → GMLSTAARAAGCSYASSSSTQSAILCGVQGQPETP

Note: No experimental confirmation available.
Show »
Length:645
Mass (Da):72,114
Checksum:i116AA3F154046C61
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RP56A0A0U1RP56_MOUSE
Zinc finger protein 710
Zfp710
31Annotation score:

Sequence cautioni

The sequence AAH58640 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH60641 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC40892 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5M → L in BAE32948 (PubMed:16141072).Curated1
Sequence conflicti259D → E in BAE32948 (PubMed:16141072).Curated1
Sequence conflicti409H → R in BAC39083 (PubMed:16141072).Curated1
Sequence conflicti620D → G in BAE32948 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018152611 – 666DPMME…YYNVL → GGWAVRSGQSRIDSSMAHSG VSSPIRGVGGLAKAETSMRW AQVWREGEPGEPLWQ in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_026943611 – 666DPMME…YYNVL → GMLSTAARAAGCSYASSSST QSAILCGVQGQPETP in isoform 3. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK036711 mRNA Translation: BAC29546.1
AK083979 mRNA Translation: BAC39083.1
AK089457 mRNA Translation: BAC40892.1 Different initiation.
AK154871 mRNA Translation: BAE32892.1
AK154953 mRNA Translation: BAE32948.1
AK155416 mRNA Translation: BAE33254.1
BC058640 mRNA Translation: AAH58640.3 Different initiation.
BC060641 mRNA Translation: AAH60641.1 Different initiation.
CCDSiCCDS52279.1 [Q3U288-3]
CCDS52280.1 [Q3U288-1]
RefSeqiNP_001139471.1, NM_001145999.1 [Q3U288-1]
NP_001139472.1, NM_001146000.1 [Q3U288-3]
NP_780642.3, NM_175433.5 [Q3U288-1]
XP_006540805.1, XM_006540742.3 [Q3U288-1]
XP_006540806.1, XM_006540743.3 [Q3U288-1]
XP_006540807.1, XM_006540744.3 [Q3U288-1]
UniGeneiMm.290925

Genome annotation databases

EnsembliENSMUST00000049680; ENSMUSP00000050577; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000164056; ENSMUSP00000132361; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000166250; ENSMUSP00000129357; ENSMUSG00000048897 [Q3U288-3]
ENSMUST00000206039; ENSMUSP00000146148; ENSMUSG00000048897 [Q3U288-2]
GeneIDi209225
KEGGimmu:209225
UCSCiuc009hzi.2 mouse [Q3U288-3]
uc009hzj.2 mouse [Q3U288-1]
uc009hzk.2 mouse [Q3U288-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK036711 mRNA Translation: BAC29546.1
AK083979 mRNA Translation: BAC39083.1
AK089457 mRNA Translation: BAC40892.1 Different initiation.
AK154871 mRNA Translation: BAE32892.1
AK154953 mRNA Translation: BAE32948.1
AK155416 mRNA Translation: BAE33254.1
BC058640 mRNA Translation: AAH58640.3 Different initiation.
BC060641 mRNA Translation: AAH60641.1 Different initiation.
CCDSiCCDS52279.1 [Q3U288-3]
CCDS52280.1 [Q3U288-1]
RefSeqiNP_001139471.1, NM_001145999.1 [Q3U288-1]
NP_001139472.1, NM_001146000.1 [Q3U288-3]
NP_780642.3, NM_175433.5 [Q3U288-1]
XP_006540805.1, XM_006540742.3 [Q3U288-1]
XP_006540806.1, XM_006540743.3 [Q3U288-1]
XP_006540807.1, XM_006540744.3 [Q3U288-1]
UniGeneiMm.290925

3D structure databases

ProteinModelPortaliQ3U288
SMRiQ3U288
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000050577

PTM databases

iPTMnetiQ3U288
PhosphoSitePlusiQ3U288

Proteomic databases

MaxQBiQ3U288
PaxDbiQ3U288
PeptideAtlasiQ3U288
PRIDEiQ3U288

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000049680; ENSMUSP00000050577; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000164056; ENSMUSP00000132361; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000166250; ENSMUSP00000129357; ENSMUSG00000048897 [Q3U288-3]
ENSMUST00000206039; ENSMUSP00000146148; ENSMUSG00000048897 [Q3U288-2]
GeneIDi209225
KEGGimmu:209225
UCSCiuc009hzi.2 mouse [Q3U288-3]
uc009hzj.2 mouse [Q3U288-1]
uc009hzk.2 mouse [Q3U288-2]

Organism-specific databases

CTDi209225
MGIiMGI:1921747 Zfp710

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00750000117653
HOVERGENiHBG066266
InParanoidiQ3U288
OMAiPEVYQLA
OrthoDBiEOG091G02N1
PhylomeDBiQ3U288
TreeFamiTF331510

Enzyme and pathway databases

ReactomeiR-MMU-212436 Generic Transcription Pathway

Miscellaneous databases

PROiPR:Q3U288
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000048897 Expressed in 201 organ(s), highest expression level in skeletal muscle tissue
CleanExiMM_ZFP710
ExpressionAtlasiQ3U288 baseline and differential
GenevisibleiQ3U288 MM

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 9 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 11 hits
SUPFAMiSSF57667 SSF57667, 6 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 11 hits
PS50157 ZINC_FINGER_C2H2_2, 11 hits
ProtoNetiSearch...

Entry informationi

Entry nameiZN710_MOUSE
AccessioniPrimary (citable) accession number: Q3U288
Secondary accession number(s): Q3U341
, Q3U396, Q6P9R3, Q8BJH0, Q8BTL6, Q8BZ48
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: October 11, 2005
Last modified: November 7, 2018
This is version 111 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again