Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q3U288 (ZN710_MOUSE)

Entry version 125 (23 Feb 2022)
Sequence version 1 (11 Oct 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein 710

Gene

Znf710

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri297 – 319C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri325 – 347C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri465 – 487C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri493 – 515C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri521 – 543C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri549 – 571C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri577 – 600C2H2-type 11PROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-212436, Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 710
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Znf710
Synonyms:Zfp710
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1921747, Zfp710

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000048897

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002337091 – 666Zinc finger protein 710Add BLAST666

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki110Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki113Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki379Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q3U288

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q3U288

PeptideAtlas

More...PeptideAtlasi		Q3U288

PRoteomics IDEntifications database

More...PRIDEi		Q3U288

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		275032 [Q3U288-1]
275033 [Q3U288-2]
275034 [Q3U288-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q3U288

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q3U288

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000048897, Expressed in skeletal muscle tissue and 227 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q3U288, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		229060, 33 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000050577

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q3U288, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q3U288

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni113 – 141DisorderedSequence analysisAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri297 – 319C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri325 – 347C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri353 – 375C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri381 – 403C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri409 – 431C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri437 – 459C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri465 – 487C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri493 – 515C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri521 – 543C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri549 – 571C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri577 – 600C2H2-type 11PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155498

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002678_54_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q3U288

Identification of Orthologs from Complete Genome Data

More...OMAi		MEDYEEN

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q3U288

TreeFam database of animal gene trees

More...TreeFami		TF331510

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00096, zf-C2H2, 10 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00355, ZnF_C2H2, 11 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667, SSF57667, 6 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 11 hits
PS50157, ZINC_FINGER_C2H2_2, 11 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3U288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGFMDSGTQ TDAVVVLSLA QAAVLGLVSE NELFGATISA EAFYPDLGPE 
        60         70         80         90        100
LTGTAMGEPG PPGPDIYQLA CNGRALEEPP EEEVLEVEAA FEKHTRRKTR 
       110        120        130        140        150
PPVRLVPKVK FEKAEEEEEQ EVYEVSVPGD DKDPGPAEAP AEVASSGCEA 
       160        170        180        190        200
LVQSSAVKMI DLSAFSRKPR TLRHLPRTPR PELDMAPFDP PFPDPARDGF 
       210        220        230        240        250
PEPSMALPGP ETLPTECSFE PPHLAPLSNP EPPNMTSTTE LVKPEQGFVW 
       260        270        280        290        300
QESSEFEADT AGSTVERHKK AQLDRLDINV QIDDSYLVEA GDRQKRWQCR 
       310        320        330        340        350
MCEKSYTSKY NLVTHILGHN GIKPHSCPHC SKLFKQPSHL QTHLLTHQGT 
       360        370        380        390        400
RPHKCQVCHK AFTQTSHLKR HMLLHSEVKP YSCHFCGRGF AYPSELKAHE 
       410        420        430        440        450
VKHESGRCHV CVECGLDFST LTQLKRHLAS HQGPTLYQCL ECDKSFHYRS 
       460        470        480        490        500
QLQNHMLKHQ NVRPFVCTEC GMEFSQIHHL KQHSLTHKGV KEFKCEVCGR 
       510        520        530        540        550
EFTLQANMKR HMLIHTSVRP YQCHICFKTF VQKQTLKTHM IVHSPVKPFK 
       560        570        580        590        600
CKVCGKSFNR MYNLLGHMHL HAGSKPFKCP YCSSKFNLKG NLSRHMKVKH 
       610        620        630        640        650
GVMDISLDSQ DPMMELAGPD PSELDNHQEM EDFEENAYTY SSVDSSAEAS 
       660 
TLTEQAMKEM AYYNVL
Length:666
Mass (Da):75,052
Last modified:October 11, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i726110C48EAD2054
GO
Isoform 2 (identifier: Q3U288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     611-666: DPMMELAGPD...MKEMAYYNVL → GGWAVRSGQS...EGEPGEPLWQ

Show »
Length:665
Mass (Da):74,620
Checksum:iE45CD9E0C856BE1F
GO
Isoform 3 (identifier: Q3U288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     611-666: DPMMELAGPD...MKEMAYYNVL → GMLSTAARAAGCSYASSSSTQSAILCGVQGQPETP

Show »
Length:645
Mass (Da):72,114
Checksum:i116AA3F154046C61
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RP56A0A0U1RP56_MOUSE
Zinc finger protein 710
Zfp710
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH58640 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH60641 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC40892 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti5M → L in BAE32948 (PubMed:16141072).Curated1
Sequence conflicti259D → E in BAE32948 (PubMed:16141072).Curated1
Sequence conflicti409H → R in BAC39083 (PubMed:16141072).Curated1
Sequence conflicti620D → G in BAE32948 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018152611 – 666DPMME…YYNVL → GGWAVRSGQSRIDSSMAHSG VSSPIRGVGGLAKAETSMRW AQVWREGEPGEPLWQ in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_026943611 – 666DPMME…YYNVL → GMLSTAARAAGCSYASSSST QSAILCGVQGQPETP in isoform 3. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK036711 mRNA Translation: BAC29546.1
AK083979 mRNA Translation: BAC39083.1
AK089457 mRNA Translation: BAC40892.1 Different initiation.
AK154871 mRNA Translation: BAE32892.1
AK154953 mRNA Translation: BAE32948.1
AK155416 mRNA Translation: BAE33254.1
BC058640 mRNA Translation: AAH58640.3 Different initiation.
BC060641 mRNA Translation: AAH60641.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS52279.1 [Q3U288-3]
CCDS52280.1 [Q3U288-1]

NCBI Reference Sequences

More...RefSeqi		NP_001139471.1, NM_001145999.1 [Q3U288-1]
NP_001139472.1, NM_001146000.1 [Q3U288-3]
NP_780642.3, NM_175433.5 [Q3U288-1]
XP_006540805.1, XM_006540742.3 [Q3U288-1]
XP_006540806.1, XM_006540743.3 [Q3U288-1]
XP_006540807.1, XM_006540744.3 [Q3U288-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000049680; ENSMUSP00000050577; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000164056; ENSMUSP00000132361; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000166250; ENSMUSP00000129357; ENSMUSG00000048897 [Q3U288-3]
ENSMUST00000206039; ENSMUSP00000146148; ENSMUSG00000048897 [Q3U288-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		209225

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:209225

UCSC genome browser

More...UCSCi		uc009hzi.2, mouse [Q3U288-3]
uc009hzj.2, mouse [Q3U288-1]
uc009hzk.2, mouse [Q3U288-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK036711 mRNA Translation: BAC29546.1
AK083979 mRNA Translation: BAC39083.1
AK089457 mRNA Translation: BAC40892.1 Different initiation.
AK154871 mRNA Translation: BAE32892.1
AK154953 mRNA Translation: BAE32948.1
AK155416 mRNA Translation: BAE33254.1
BC058640 mRNA Translation: AAH58640.3 Different initiation.
BC060641 mRNA Translation: AAH60641.1 Different initiation.
CCDSiCCDS52279.1 [Q3U288-3]
CCDS52280.1 [Q3U288-1]
RefSeqiNP_001139471.1, NM_001145999.1 [Q3U288-1]
NP_001139472.1, NM_001146000.1 [Q3U288-3]
NP_780642.3, NM_175433.5 [Q3U288-1]
XP_006540805.1, XM_006540742.3 [Q3U288-1]
XP_006540806.1, XM_006540743.3 [Q3U288-1]
XP_006540807.1, XM_006540744.3 [Q3U288-1]

3D structure databases

SMRiQ3U288
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi229060, 33 interactors
STRINGi10090.ENSMUSP00000050577

PTM databases

iPTMnetiQ3U288
PhosphoSitePlusiQ3U288

Proteomic databases

MaxQBiQ3U288
PaxDbiQ3U288
PeptideAtlasiQ3U288
PRIDEiQ3U288
ProteomicsDBi275032 [Q3U288-1]
275033 [Q3U288-2]
275034 [Q3U288-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		209225

Genome annotation databases

EnsembliENSMUST00000049680; ENSMUSP00000050577; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000164056; ENSMUSP00000132361; ENSMUSG00000048897 [Q3U288-1]
ENSMUST00000166250; ENSMUSP00000129357; ENSMUSG00000048897 [Q3U288-3]
ENSMUST00000206039; ENSMUSP00000146148; ENSMUSG00000048897 [Q3U288-2]
GeneIDi209225
KEGGimmu:209225
UCSCiuc009hzi.2, mouse [Q3U288-3]
uc009hzj.2, mouse [Q3U288-1]
uc009hzk.2, mouse [Q3U288-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		209225
MGIiMGI:1921747, Zfp710
VEuPathDBiHostDB:ENSMUSG00000048897

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000155498
HOGENOMiCLU_002678_54_1_1
InParanoidiQ3U288
OMAiMEDYEEN
OrthoDBi1318335at2759
PhylomeDBiQ3U288
TreeFamiTF331510

Enzyme and pathway databases

ReactomeiR-MMU-212436, Generic Transcription Pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		209225, 5 hits in 67 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Zfp710, mouse

Protein Ontology

More...PROi		PR:Q3U288
RNActiQ3U288, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000048897, Expressed in skeletal muscle tissue and 227 other tissues
GenevisibleiQ3U288, MM

Family and domain databases

InterProiView protein in InterPro
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF00096, zf-C2H2, 10 hits
SMARTiView protein in SMART
SM00355, ZnF_C2H2, 11 hits
SUPFAMiSSF57667, SSF57667, 6 hits
PROSITEiView protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 11 hits
PS50157, ZINC_FINGER_C2H2_2, 11 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN710_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3U288
Secondary accession number(s): Q3U341
, Q3U396, Q6P9R3, Q8BJH0, Q8BTL6, Q8BZ48
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: October 11, 2005
Last modified: February 23, 2022
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again