Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (26 Feb 2020)
Sequence version 1 (11 Oct 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

AT-rich interactive domain-containing protein 5A

Gene

Arid5a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA-binding protein that may regulate transcription and act as a repressor by binding to AT-rich stretches in the promoter region of target genes (By similarity). May positively regulate chondrocyte-specific transcription such as of COL2A1 in collaboration with SOX9 and positively regulate histone H3 acetylation at chondrocyte-specific genes. May stimulate early-stage chondrocyte differentiation and inhibit later stage differention (PubMed:21346191). Can repress ESR1-mediated transcriptional activation; proposed to act as corepressor for selective nuclear hormone receptors (By similarity). As RNA-binding protein involved in the regulation of inflammatory response by stabilizing selective inflammation-related mRNAs, such as IL6, STAT3 and TBX21. Binds to stem loop structures located in the 3'UTRs of IL6, STAT3 and TBX21 mRNAs; at least for STAT3 prevents binding of ZC3H12A to the mRNA stem loop structure thus inhibiting its degradation activity. Contributes to elevated IL6 levels possibly implicated in autoimmunity processes. IL6-dependent stabilization of STAT3 mRNA may promote differentiation of naive CD4+ T-cells into T-helper Th17 cells (PubMed:23676272, PubMed:27022145). In CD4+ T-cells may also inhibit RORC-induced Th17 cell differentiation independently of IL6 signaling (PubMed:24782182). Stabilization of TBX21 mRNA contributes to elevated interferon-gamma secretion in Th1 cells possibly implicated in the establishment of septic shock (PubMed:27671645). Stabilizes TNFRSF4/OX40 mRNA by binding to the conserved stem loop structure in its 3'UTR; thereby competing with the mRNA-destabilizing functions of RC3H1 and endoribonuclease ZC3H12A (PubMed:29244194).By similarity6 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor, RNA-binding
Biological processImmunity, Innate immunity, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
AT-rich interactive domain-containing protein 5A
Short name:
ARID domain-containing protein 5A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Arid5a
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443039 Arid5a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are resistant to experimental autoimmune encephalomyelitis (EAE), a T-cell-mediated autoimmune model (PubMed:29244194). The expression of pro-inflammatory mediators is severely reduced in EAE (PubMed:29244194).1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi128R → A: Abolishes binding to STAT3 3'UTR stem loop structure. Abolishes binding to TNFRSF4/OX40 mRNA. 2 Publications1
Mutagenesisi253S → A: Abolishes ubiquitination; largely impairs proteasomal degradation; results in overproduction of IL-6 upon overexpression; in association with A-433 and A-458. 1 Publication1
Mutagenesisi433S → A: Abolishes ubiquitination; largely impairs proteasomal degradation; results in overproduction of IL-6 upon overexpression; in association with A-253 and A-458. 1 Publication1
Mutagenesisi458S → A: Abolishes ubiquitination; largely impairs proteasomal degradation; results in overproduction of IL-6 upon overexpression; in association with A-253 and A-433. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002889311 – 590AT-rich interactive domain-containing protein 5AAdd BLAST590

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki89Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Modified residuei253Phosphoserine1 Publication1
Modified residuei283PhosphoserineCombined sources1
Modified residuei433Phosphoserine1 Publication1
Modified residuei458Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by MAPK14 on serine residues involving a TLR4 signaling pathway upon lipopolysaccharide (LPS) stimulation leading to its ubiquitination and proteasomal degradation.1 Publication
Ubiquitinated leading to proteasomal degradation; involving WWP1 linked to MAPK14-mediated phosphorylation upon LPS stimulation.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
non-CPTAC-3309

Encyclopedia of Proteome Dynamics

More...
EPDi
Q3U108

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3U108

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3U108

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3U108

PRoteomics IDEntifications database

More...
PRIDEi
Q3U108

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3U108

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3U108

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in T cells (at protein level) (PubMed:29244194). Expressed at high levels in cartilage, heart, testis and bone (PubMed:21346191).2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

In macrophages by LPS, IL1B and IL6 (PubMed:21346191). By IL6/STAT3 signaling in T-helper Th17 cells (PubMed:24782182, PubMed:29244194).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037447 Expressed in bone marrow and 82 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3U108 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3U108 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SOX9 (PubMed:21346191).

Interacts with ESR1 (By similarity).

Interacts with RORC (PubMed:24782182).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P484363EBI-14022639,EBI-3920028From Homo sapiens.

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q3U108, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000110684

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3U108 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3U108

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini50 – 142ARIDPROSITE-ProRule annotationAdd BLAST93

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 294Interaction with SOX91 PublicationAdd BLAST294

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IQ79 Eukaryota
ENOG4111RDB LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161253

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_032275_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3U108

Identification of Orthologs from Complete Genome Data

More...
OMAi
HPRDFFP

Database of Orthologous Groups

More...
OrthoDBi
368297at2759

TreeFam database of animal gene trees

More...
TreeFami
TF324725

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001606 ARID_dom
IPR036431 ARID_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01388 ARID, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00501 BRIGHT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46774 SSF46774, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51011 ARID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3U108-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPPAKGNT EQSEEGDLPQ LPVSPKPDDE QSRSQSPTQL QDSPEAGGEQ
60 70 80 90 100
EEEQAFLVSL YKFMKERHTP IERVPHLGFK QINLWKIYKA VEKLGAYELV
110 120 130 140 150
TGRRLWKNVY DELGGSPGST SAATCTRRHY ERLVLPYVRH LKGEDDKPLP
160 170 180 190 200
PTKPRKQYKM AKELRGDDGT TEKLKKAKDS EERRVEQTTP GKTKSDATGQ
210 220 230 240 250
TQLPCQGSSR DSTEQLGPVS GPSPPLTGAS SCPEAYKRLL SSFYCKGAHG
260 270 280 290 300
IMSPLAKKKL LAQVSKAEAL QCQEEGCRHG ARSPNKDIQD SPQNLRGPAE
310 320 330 340 350
NSEHQLTPRE GLQAPGGSTR MEAQVGPCPT APMFSGCFHA YPTEVLKPVS
360 370 380 390 400
QHPRDFFSGL KDRVLLGPPG KEEGPTTKES HLVWGGDANH PSAFHKGSTR
410 420 430 440 450
KRSFYPKPKA CWVSPMAKVP TERPGAPSPH PSSPGLGSKR GLEEEGFAHG
460 470 480 490 500
GKKLRAVSPF LKEVDSKETG GKPAAPGLAV SCLLGPTPGP TPPEAYRGTM
510 520 530 540 550
LRCPLNFTGS ADPLKGQASL PFSPLVIPAF PAHLLATTGS SPMAASLMHF
560 570 580 590
PPTPYDAVLR NRLGPASSAW HMPPVTTYAA PHFFHLNTKL
Length:590
Mass (Da):63,898
Last modified:October 11, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD4C00C2F1DEBDCC3
GO
Isoform 2 (identifier: Q3U108-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-2: MA → MLKGGRPDLCVVNSLIKLQKLKLHVDAEHQT

Show »
Length:619
Mass (Da):67,163
Checksum:i45AF3962604B372A
GO
Isoform 3 (identifier: Q3U108-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-2: Missing.
     81-82: QI → QSASLGGGGW...DRLPCLFPSV

Show »
Length:684
Mass (Da):73,323
Checksum:i9156EB0980CD3F35
GO
Isoform 4 (identifier: Q3U108-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-99: Missing.

Show »
Length:532
Mass (Da):57,124
Checksum:iEC8556C8C58565C9
GO
Isoform 5 (identifier: Q3U108-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.

Show »
Length:431
Mass (Da):45,846
Checksum:i62191DF092B2A60E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z0W0D3Z0W0_MOUSE
AT-rich interactive domain-containi...
Arid5a
619Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z085D3Z085_MOUSE
AT-rich interactive domain-containi...
Arid5a
256Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z7U1D3Z7U1_MOUSE
AT-rich interactive domain-containi...
Arid5a
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KMU9J3KMU9_MOUSE
AT-rich interactive domain-containi...
Arid5a
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti51E → K in BAE34133 (PubMed:16141072).Curated1
Sequence conflicti94L → Q in BAE29358 (PubMed:16141072).Curated1
Sequence conflicti540S → P in AAH27152 (PubMed:15489334).Curated1
Sequence conflicti585H → R in BAE29115 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0258381 – 159Missing in isoform 5. 2 PublicationsAdd BLAST159
Alternative sequenceiVSP_0258391 – 2MA → MLKGGRPDLCVVNSLIKLQK LKLHVDAEHQT in isoform 2. 1 Publication2
Alternative sequenceiVSP_0258402Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_02584142 – 99Missing in isoform 4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_02584281 – 82QI → QSASLGGGGWCSGRVSVGGQ QPGDVPRQDNRQGTSAKGDP GCRQPVGVACEDGASLKARG GVGFSSSWAACPVHNSGPAW ECGVTEPDRLPCLFPSV in isoform 3. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK041344 mRNA Translation: BAC30913.1
AK085015 mRNA Translation: BAC39338.1
AK149839 mRNA Translation: BAE29115.1
AK150170 mRNA Translation: BAE29358.1
AK156376 mRNA Translation: BAE33692.1
AK156622 mRNA Translation: BAE33779.1
AK156934 mRNA Translation: BAE33904.1
AK157607 mRNA Translation: BAE34133.1
BC027152 mRNA Translation: AAH27152.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14876.1 [Q3U108-4]
CCDS48239.1 [Q3U108-1]
CCDS69878.1 [Q3U108-5]
CCDS78560.1 [Q3U108-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001165676.1, NM_001172205.1 [Q3U108-1]
NP_001165677.1, NM_001172206.1
NP_001277655.1, NM_001290726.1
NP_001277656.1, NM_001290727.1 [Q3U108-5]
NP_666108.2, NM_145996.4 [Q3U108-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000115029; ENSMUSP00000110681; ENSMUSG00000037447 [Q3U108-5]
ENSMUST00000115032; ENSMUSP00000110684; ENSMUSG00000037447 [Q3U108-1]
ENSMUST00000115031; ENSMUSP00000110683; ENSMUSG00000037447 [Q3U108-3]
ENSMUST00000137906; ENSMUSP00000117810; ENSMUSG00000037447 [Q3U108-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
214855

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:214855

UCSC genome browser

More...
UCSCi
uc007apu.2 mouse [Q3U108-4]
uc007apv.2 mouse [Q3U108-1]
uc007apy.2 mouse [Q3U108-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK041344 mRNA Translation: BAC30913.1
AK085015 mRNA Translation: BAC39338.1
AK149839 mRNA Translation: BAE29115.1
AK150170 mRNA Translation: BAE29358.1
AK156376 mRNA Translation: BAE33692.1
AK156622 mRNA Translation: BAE33779.1
AK156934 mRNA Translation: BAE33904.1
AK157607 mRNA Translation: BAE34133.1
BC027152 mRNA Translation: AAH27152.1
CCDSiCCDS14876.1 [Q3U108-4]
CCDS48239.1 [Q3U108-1]
CCDS69878.1 [Q3U108-5]
CCDS78560.1 [Q3U108-2]
RefSeqiNP_001165676.1, NM_001172205.1 [Q3U108-1]
NP_001165677.1, NM_001172206.1
NP_001277655.1, NM_001290726.1
NP_001277656.1, NM_001290727.1 [Q3U108-5]
NP_666108.2, NM_145996.4 [Q3U108-4]

3D structure databases

SMRiQ3U108
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ3U108, 2 interactors
STRINGi10090.ENSMUSP00000110684

PTM databases

iPTMnetiQ3U108
PhosphoSitePlusiQ3U108

Proteomic databases

CPTACinon-CPTAC-3309
EPDiQ3U108
jPOSTiQ3U108
MaxQBiQ3U108
PaxDbiQ3U108
PRIDEiQ3U108

Genome annotation databases

EnsembliENSMUST00000115029; ENSMUSP00000110681; ENSMUSG00000037447 [Q3U108-5]
ENSMUST00000115032; ENSMUSP00000110684; ENSMUSG00000037447 [Q3U108-1]
ENSMUST00000115031; ENSMUSP00000110683; ENSMUSG00000037447 [Q3U108-3]
ENSMUST00000137906; ENSMUSP00000117810; ENSMUSG00000037447 [Q3U108-4]
GeneIDi214855
KEGGimmu:214855
UCSCiuc007apu.2 mouse [Q3U108-4]
uc007apv.2 mouse [Q3U108-1]
uc007apy.2 mouse [Q3U108-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10865
MGIiMGI:2443039 Arid5a

Phylogenomic databases

eggNOGiENOG410IQ79 Eukaryota
ENOG4111RDB LUCA
GeneTreeiENSGT00940000161253
HOGENOMiCLU_032275_0_0_1
InParanoidiQ3U108
OMAiHPRDFFP
OrthoDBi368297at2759
TreeFamiTF324725

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q3U108
RNActiQ3U108 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037447 Expressed in bone marrow and 82 other tissues
ExpressionAtlasiQ3U108 baseline and differential
GenevisibleiQ3U108 MM

Family and domain databases

Gene3Di1.10.150.60, 1 hit
InterProiView protein in InterPro
IPR001606 ARID_dom
IPR036431 ARID_dom_sf
PfamiView protein in Pfam
PF01388 ARID, 1 hit
SMARTiView protein in SMART
SM00501 BRIGHT, 1 hit
SUPFAMiSSF46774 SSF46774, 1 hit
PROSITEiView protein in PROSITE
PS51011 ARID, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARI5A_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3U108
Secondary accession number(s): Q3TZS4
, Q3U0F0, Q3U0S2, Q3UDA3, Q3UDZ6, Q8BI45, Q8BYB5, Q8R2W1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: October 11, 2005
Last modified: February 26, 2020
This is version 109 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again