Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q3TUL7 (DCA17_MOUSE)

Entry version 101 (10 Feb 2021)
Sequence version 1 (11 Oct 2005)
Previous versions | rss
Add a publicationFeedback
Protein

DDB1- and CUL4-associated factor 17

Gene

Dcaf17

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-8951664, Neddylation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DDB1- and CUL4-associated factor 17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dcaf17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1923013, Dcaf17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei186 – 206HelicalSequence analysisAdd BLAST21
Transmembranei222 – 242HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003001191 – 519DDB1- and CUL4-associated factor 17Add BLAST519

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q3TUL7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q3TUL7

PRoteomics IDEntifications database

More...PRIDEi		Q3TUL7

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q3TUL7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed in the embryo, with higher expression in brain, liver and skin tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000041966, Expressed in ear vesicle and 264 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q3TUL7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q3TUL7, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DDB1, CUL4A and CUL4B.

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000120016

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q3TUL7, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi510 – 513Poly-Glu4

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QQ41, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000012728

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_604033_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q3TUL7

Identification of Orthologs from Complete Genome Data

More...OMAi		GGFPWHY

Database of Orthologous Groups

More...OrthoDBi		1292766at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q3TUL7

TreeFam database of animal gene trees

More...TreeFami		TF328801

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR031620, DCAF17

The PANTHER Classification System

More...PANTHERi		PTHR14815, PTHR14815, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15802, DCAF17, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3TUL7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGRTRKANVC RRLSRRALGF YARDAGVVQR TNLGILRALV CQESTKFKNV 
        60         70         80         90        100
WTTHSKSPIA YERGRIYFDN YRCCVSSVAS EPRKLYEMPK CSKSEKIEDA 
       110        120        130        140        150
LLWECPVGDI LPDPSDYKSS LIALTAHNWL LRISATTGEV LEKIYLASYC 
       160        170        180        190        200
KFRYLSWDTP QEVIAVKSAQ NKGSAAARQA GTSPPVLLYL AVFRVLPFSL 
       210        220        230        240        250
VGILEINKKV FENVTDATLS HGILIVMYSS GLVRLYSFQA IIEQFMQQKL 
       260        270        280        290        300
DLGCACSQGG TTGTVGEAPF GIPCNVKITD SPPPLFEVSS LENAFQIGGH 
       310        320        330        340        350
PWHYIITPNK KKQKGVFHIC ALKDNSLAKN GIQEMECCSL ESDWIYFHPD 
       360        370        380        390        400
ASGRIIHVGP NQVKVLKLSE VENDSSQHQI SEDFVIWAKR EDRKENLITV 
       410        420        430        440        450
TASGRVVKRN VSLLDDDPEQ ETFKIVDYED ELDLLSVVAV TQIDAEGKAH 
       460        470        480        490        500
LDFHCNEYGT LLKSIPLVES WDVTYSHEVY FDRDLVLHIE QKPNRVFSCY 
       510 
VYQMVCDPGE EEEAVNRSG
Length:519
Mass (Da):58,400
Last modified:October 11, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE22D2926D3FDAFD6
GO
Isoform 2 (identifier: Q3TUL7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     474-519: TYSHEVYFDR...EEEEAVNRSG → VCIMSGTLSCKGFLYRCHLLDHVHISPDSPVL

Show »
Length:505
Mass (Da):56,488
Checksum:i847419DF88EB996E
GO
Isoform 3 (identifier: Q3TUL7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-286: FMQQKLDLGC...KITDSPPPLF → THHLHSLKFH...NRKEFFIFVP
     287-519: Missing.

Show »
Length:286
Mass (Da):32,578
Checksum:iF54529CA5A695018
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B0R0U2B0R0U2_MOUSE
DDB1- and CUL4-associated factor 17
Dcaf17
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Z4YK64Z4YK64_MOUSE
DDB1- and CUL4-associated factor 17
Dcaf17
505Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6YAD1F6YAD1_MOUSE
DDB1- and CUL4-associated factor 17
Dcaf17
405Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WIJ2F8WIJ2_MOUSE
DDB1- and CUL4-associated factor 17
Dcaf17
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XZ79F6XZ79_MOUSE
DDB1- and CUL4-associated factor 17
Dcaf17
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q3TUL7-2)
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti477M → T in CAM22154 (PubMed:19468303).Curated1
Sequence conflicti504V → M in CAM22154 (PubMed:19468303).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027790245 – 286FMQQK…PPPLF → THHLHSLKFHLWRTHSRLEA ILGTTSSRLIRRNRKEFFIF VP in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_027791287 – 519Missing in isoform 3. 1 PublicationAdd BLAST233
Alternative sequenceiVSP_027789474 – 519TYSHE…VNRSG → VCIMSGTLSCKGFLYRCHLL DHVHISPDSPVL in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK032671 mRNA Translation: BAC27979.1
AK160679 mRNA Translation: BAE35954.1
AL929228 Genomic DNA Translation: CAM22153.1
AL929228 Genomic DNA Translation: CAM22154.1
AL929228 Genomic DNA Translation: CAM22155.1
BC031546 mRNA Translation: AAH31546.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS16111.1 [Q3TUL7-2]
CCDS50601.1 [Q3TUL7-1]
CCDS50602.1 [Q3TUL7-3]

NCBI Reference Sequences

More...RefSeqi		NP_001159452.1, NM_001165980.1 [Q3TUL7-1]
NP_001159453.1, NM_001165981.1 [Q3TUL7-1]
NP_001159454.1, NM_001165982.1 [Q3TUL7-3]
NP_932122.2, NM_198005.2
XP_006500402.1, XM_006500339.3 [Q3TUL7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000064141; ENSMUSP00000065624; ENSMUSG00000041966 [Q3TUL7-1]
ENSMUST00000112159; ENSMUSP00000107785; ENSMUSG00000041966 [Q3TUL7-3]
ENSMUST00000154704; ENSMUSP00000120016; ENSMUSG00000041966 [Q3TUL7-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		75763

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:75763

UCSC genome browser

More...UCSCi		uc008kab.2, mouse [Q3TUL7-3]
uc008kad.2, mouse [Q3TUL7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK032671 mRNA Translation: BAC27979.1
AK160679 mRNA Translation: BAE35954.1
AL929228 Genomic DNA Translation: CAM22153.1
AL929228 Genomic DNA Translation: CAM22154.1
AL929228 Genomic DNA Translation: CAM22155.1
BC031546 mRNA Translation: AAH31546.1
CCDSiCCDS16111.1 [Q3TUL7-2]
CCDS50601.1 [Q3TUL7-1]
CCDS50602.1 [Q3TUL7-3]
RefSeqiNP_001159452.1, NM_001165980.1 [Q3TUL7-1]
NP_001159453.1, NM_001165981.1 [Q3TUL7-1]
NP_001159454.1, NM_001165982.1 [Q3TUL7-3]
NP_932122.2, NM_198005.2
XP_006500402.1, XM_006500339.3 [Q3TUL7-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000120016

PTM databases

PhosphoSitePlusiQ3TUL7

Proteomic databases

EPDiQ3TUL7
PaxDbiQ3TUL7
PRIDEiQ3TUL7

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		65882, 38 antibodies

Genome annotation databases

EnsembliENSMUST00000064141; ENSMUSP00000065624; ENSMUSG00000041966 [Q3TUL7-1]
ENSMUST00000112159; ENSMUSP00000107785; ENSMUSG00000041966 [Q3TUL7-3]
ENSMUST00000154704; ENSMUSP00000120016; ENSMUSG00000041966 [Q3TUL7-1]
GeneIDi75763
KEGGimmu:75763
UCSCiuc008kab.2, mouse [Q3TUL7-3]
uc008kad.2, mouse [Q3TUL7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		80067
MGIiMGI:1923013, Dcaf17

Phylogenomic databases

eggNOGiENOG502QQ41, Eukaryota
GeneTreeiENSGT00390000012728
HOGENOMiCLU_604033_0_0_1
InParanoidiQ3TUL7
OMAiGGFPWHY
OrthoDBi1292766at2759
PhylomeDBiQ3TUL7
TreeFamiTF328801

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-MMU-8951664, Neddylation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		75763, 0 hits in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Dcaf17, mouse

Protein Ontology

More...PROi		PR:Q3TUL7
RNActiQ3TUL7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000041966, Expressed in ear vesicle and 264 other tissues
ExpressionAtlasiQ3TUL7, baseline and differential
GenevisibleiQ3TUL7, MM

Family and domain databases

InterProiView protein in InterPro
IPR031620, DCAF17
PANTHERiPTHR14815, PTHR14815, 1 hit
PfamiView protein in Pfam
PF15802, DCAF17, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDCA17_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3TUL7
Secondary accession number(s): A2AUU6, Q8C002, Q8K0F5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: October 11, 2005
Last modified: February 10, 2021
This is version 101 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again