Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 115 (18 Sep 2019)
Sequence version 2 (26 Jun 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neuropathy target esterase

Gene

Pnpla6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Phospholipase B that deacylates intracellular phosphatidylcholine (PtdCho), generating glycerophosphocholine (GroPtdCho). This deacylation occurs at both sn-2 and sn-1 positions of PtdCho. Its specific chemical modification by certain organophosphorus (OP) compounds leads to distal axonopathy.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by a series a OPs such as mipafox (MPX), phenyl saligenin phosphate (PSP), phenyl dipentyl phosphinate (PDPP), diisopropyl fluorophosphate and paraoxon.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei994NucleophilePROSITE-ProRule annotation1
Active sitei1114Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi179 – 306cNMP 1Add BLAST128
Nucleotide bindingi492 – 614cNMP 2Add BLAST123
Nucleotide bindingi610 – 730cNMP 3Add BLAST121

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processLipid degradation, Lipid metabolism

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-6814848 Glycerophospholipid catabolism

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuropathy target esterase (EC:3.1.1.5)
Alternative name(s):
Patatin-like phospholipase domain-containing protein 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pnpla6
Synonyms:Nte
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1354723 Pnpla6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 43LumenalSequence analysisAdd BLAST43
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei44 – 64HelicalSequence analysisAdd BLAST21
Topological domaini65 – 1355CytoplasmicSequence analysisAdd BLAST1291

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3259506

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002922001 – 1355Neuropathy target esteraseAdd BLAST1355

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi9N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei338PhosphoserineBy similarity1
Modified residuei345PhosphothreonineBy similarity1
Modified residuei346PhosphoserineBy similarity1
Modified residuei356PhosphoserineBy similarity1
Modified residuei405PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3TRM4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3TRM4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3TRM4

PeptideAtlas

More...
PeptideAtlasi
Q3TRM4

PRoteomics IDEntifications database

More...
PRIDEi
Q3TRM4

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2555

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3TRM4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3TRM4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q3TRM4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed ubiquitously in brain of young mice. Reaching adulthood, there is a most prominent expression in Purkinje cells, granule cells and pyramidal neurons of the hippocampus and some large neurons in the medulla oblongata, nucleus dentatus and pons.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the embryonic respiratory system, different epithelial structures and strongly in the spinal ganglia, during the development.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000004565 Expressed in 283 organ(s), highest expression level in cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3TRM4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3TRM4 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
206099, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106699

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini961 – 1127PNPLAPROSITE-ProRule annotationAdd BLAST167

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi965 – 970GXGXXGPROSITE-ProRule annotation6
Motifi992 – 996GXSXGPROSITE-ProRule annotation5
Motifi1114 – 1116DGA/GPROSITE-ProRule annotation3

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NTE family.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2968 Eukaryota
COG0664 LUCA
COG1752 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159130

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000016081

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3TRM4

KEGG Orthology (KO)

More...
KOi
K14676

Database of Orthologous Groups

More...
OrthoDBi
253518at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3TRM4

TreeFam database of animal gene trees

More...
TreeFami
TF300519

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00038 CAP_ED, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR018490 cNMP-bd-like
IPR000595 cNMP-bd_dom
IPR001423 LysoPLipase_patatin_CS
IPR002641 PNPLA_dom
IPR014710 RmlC-like_jellyroll

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00027 cNMP_binding, 3 hits
PF01734 Patatin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00100 cNMP, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51206 SSF51206, 3 hits
SSF52151 SSF52151, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50042 CNMP_BINDING_3, 3 hits
PS51635 PNPLA, 1 hit
PS01237 UPF0028, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3TRM4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGTPSHELNT TSSGAEVIQK TLEEGLGRRI CVAQPVPFVP QVLGVMIGAG
60 70 80 90 100
VAVLVTAVLI LLVVRRLRVQ KTPAPEGPRY RFRKRDKVLF YGRKIMRKVS
110 120 130 140 150
QSTSSLVDTS VSTTSRPRMK KKLKMLNIAK KILRIQKETP TLQRKEPPPS
160 170 180 190 200
VLEADLTEGD LANSHLPSEV LYMLKNVRVL GHFEKPLFLE LCRHMVFQRL
210 220 230 240 250
GQGDYVFRPG QPDASIYVVQ DGLLELCLPG PDGKECVVKE VVPGDSVNSL
260 270 280 290 300
LSILDVITGH QHPQRTVSAR AARDSTVLRL PVEAFSAVFT KYPESLVRVV
310 320 330 340 350
QIIMVRLQRV TFLALHNYLG LTNELFSHEI QPLRLFPSPG LPTRTSPVRG
360 370 380 390 400
SKRVVSTSGT EDTSKETSGR PLDSIGAPLP GPAGDPVKPT SLEAPPAPLL
410 420 430 440 450
SRCISMPVDI SGLQGGPRSD FDMAYERGRI SVSLQEEASG GPQTASPREL
460 470 480 490 500
REQPAGACEY SYCEDESATG GCPFGPYQGR QTSSIFEAAK RELAKLMRIE
510 520 530 540 550
DPSLLNSRVL LHHAKAGTII ARQGDQDVSL HFVLWGCLHV YQRMIDKAEE
560 570 580 590 600
VCLFVAQPGE LVGQLAVLTG EPLIFTLRAQ RDCTFLRISK SHFYEIMRAQ
610 620 630 640 650
PSVVLSAAHT VAARMSPFVR QMDFAIDWTA VEAGRALYRQ GDRSDCTYIV
660 670 680 690 700
LNGRLRSVIQ RGSGKKELVG EYGRGDLIGV VEALTRQPRA TTVHAVRDTE
710 720 730 740 750
LAKLPEGTLG HIKRRYPQVV TRLIHLLSQK ILGNLQQLQG PFPGSGLSVP
760 770 780 790 800
QHSELTNPAS NLSTVAILPV CAEVPMMAFT LELQHALQAI GPTLLLNSDV
810 820 830 840 850
IRALLGASAL DSIQEFRLSG WLAQQEDAHR IVLYQTDTSL TPWTVRCLRQ
860 870 880 890 900
ADCILIVGLG DQEPTVGQLE QMLENTAVRA LKQLVLLHRE EGPGPTRTVE
910 920 930 940 950
WLNMRSWCSG HLHLRCPRRL FSRRSPAKLH ELYEKVFSRR ADRHSDFSRL
960 970 980 990 1000
ARVLTGNTIA LVLGGGGARG CSHIGVLKAL EEAGVPVDLV GGTSIGSFIG
1010 1020 1030 1040 1050
ALYAEERSAS RTKQRAREWA KSMTSVLEPV LDLTYPVTSM FTGSAFNRSI
1060 1070 1080 1090 1100
HRVFQDKQIE DLWLPYFNVT TDITASAMRV HKDGSLWRYV RASMTLSGYL
1110 1120 1130 1140 1150
PPLCDPKDGH LLMDGGYINN LPADIARSMG AKTVIAIDVG SQDETDLSTY
1160 1170 1180 1190 1200
GDSLSGWWLL WKRLNPWADK VKVPDMAEIQ SRLAYVSCVR QLEVVKSSSY
1210 1220 1230 1240 1250
CEYLRPSIDC FKTMDFGKFD QIYDVGYQYG KAVFGGWTRG EVIEKMLTDR
1260 1270 1280 1290 1300
RSTDLNESRR ADILAFPSSG FTDLAEIVSR IEPPTSYVSD GCADGEESDC
1310 1320 1330 1340 1350
LTEYEEDAGP DCSRDEGGSP EGASPSTASE VEEEKSTLRQ RRFLPQETPS

SVADA
Length:1,355
Mass (Da):149,537
Last modified:June 26, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i813263C6A82083ED
GO
Isoform 2 (identifier: Q3TRM4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGTPSHELNTTSSGAEVIQKTLEEGLGRRICVAQPVPFVPQ → MEAPLQTGM

Note: No experimental confirmation available.
Show »
Length:1,323
Mass (Da):146,136
Checksum:iB27BC1F45801A2A4
GO
Isoform 3 (identifier: Q3TRM4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MGTPSHELNTTSSGAEVIQKTLEEGLGRRICVAQPVPFVPQ → MEAPLQTGM
     448-448: R → RTPTQ

Note: No experimental confirmation available.
Show »
Length:1,327
Mass (Da):146,563
Checksum:i61DC2256B2C9C4F8
GO
Isoform 4 (identifier: Q3TRM4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1123-1169: ADIARSMGAK...LWKRLNPWAD → GKWLPTHICM...RGHTQLCTEL
     1170-1355: Missing.

Note: No experimental confirmation available.
Show »
Length:1,170
Mass (Da):129,347
Checksum:i34CC6F6A8FEE4B6D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A140LI54A0A140LI54_MOUSE
Neuropathy target esterase
Pnpla6
1,345Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LHU9A0A140LHU9_MOUSE
Neuropathy target esterase
Pnpla6
1,316Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LHE0A0A140LHE0_MOUSE
Neuropathy target esterase
Pnpla6
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LJH3A0A140LJH3_MOUSE
Neuropathy target esterase
Pnpla6
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LHJ7A0A140LHJ7_MOUSE
Neuropathy target esterase
Pnpla6
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LJI6A0A140LJI6_MOUSE
Neuropathy target esterase
Pnpla6
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LHT9A0A140LHT9_MOUSE
Neuropathy target esterase
Pnpla6
207Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LIJ8A0A140LIJ8_MOUSE
Neuropathy target esterase
Pnpla6
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti240E → K in AAD51700 (PubMed:10640712).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0263901 – 41MGTPS…PFVPQ → MEAPLQTGM in isoform 2 and isoform 3. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_026391448R → RTPTQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_0263921123 – 1169ADIAR…NPWAD → GKWLPTHICMDTYHQTHAHT DFCTCRLEGTGLYEWRSSRG HTQLCTEL in isoform 4. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_0263931170 – 1355Missing in isoform 4. 1 PublicationAdd BLAST186

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF173829 mRNA Translation: AAD51700.1
AK162641 mRNA Translation: BAE37004.1
AC170806 Genomic DNA No translation available.
BC054789 mRNA Translation: AAH54789.1
BC056999 mRNA Translation: AAH56999.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40206.1 [Q3TRM4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001116290.2, NM_001122818.2
NP_056616.2, NM_015801.2 [Q3TRM4-3]
XP_006508887.1, XM_006508824.3 [Q3TRM4-1]
XP_006508888.2, XM_006508825.3 [Q3TRM4-3]
XP_006508893.2, XM_006508830.3 [Q3TRM4-2]
XP_017168379.1, XM_017312890.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000004681; ENSMUSP00000004681; ENSMUSG00000004565 [Q3TRM4-3]
ENSMUST00000111070; ENSMUSP00000106699; ENSMUSG00000004565 [Q3TRM4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50767

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:50767

UCSC genome browser

More...
UCSCi
uc009krr.1 mouse [Q3TRM4-3]
uc009krs.1 mouse [Q3TRM4-2]
uc009krt.1 mouse [Q3TRM4-4]
uc009kru.1 mouse [Q3TRM4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF173829 mRNA Translation: AAD51700.1
AK162641 mRNA Translation: BAE37004.1
AC170806 Genomic DNA No translation available.
BC054789 mRNA Translation: AAH54789.1
BC056999 mRNA Translation: AAH56999.1
CCDSiCCDS40206.1 [Q3TRM4-3]
RefSeqiNP_001116290.2, NM_001122818.2
NP_056616.2, NM_015801.2 [Q3TRM4-3]
XP_006508887.1, XM_006508824.3 [Q3TRM4-1]
XP_006508888.2, XM_006508825.3 [Q3TRM4-3]
XP_006508893.2, XM_006508830.3 [Q3TRM4-2]
XP_017168379.1, XM_017312890.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi206099, 2 interactors
STRINGi10090.ENSMUSP00000106699

Chemistry databases

ChEMBLiCHEMBL3259506

PTM databases

GlyConnecti2555
iPTMnetiQ3TRM4
PhosphoSitePlusiQ3TRM4
SwissPalmiQ3TRM4

Proteomic databases

jPOSTiQ3TRM4
MaxQBiQ3TRM4
PaxDbiQ3TRM4
PeptideAtlasiQ3TRM4
PRIDEiQ3TRM4

Genome annotation databases

EnsembliENSMUST00000004681; ENSMUSP00000004681; ENSMUSG00000004565 [Q3TRM4-3]
ENSMUST00000111070; ENSMUSP00000106699; ENSMUSG00000004565 [Q3TRM4-3]
GeneIDi50767
KEGGimmu:50767
UCSCiuc009krr.1 mouse [Q3TRM4-3]
uc009krs.1 mouse [Q3TRM4-2]
uc009krt.1 mouse [Q3TRM4-4]
uc009kru.1 mouse [Q3TRM4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10908
MGIiMGI:1354723 Pnpla6

Phylogenomic databases

eggNOGiKOG2968 Eukaryota
COG0664 LUCA
COG1752 LUCA
GeneTreeiENSGT00940000159130
HOGENOMiHOG000016081
InParanoidiQ3TRM4
KOiK14676
OrthoDBi253518at2759
PhylomeDBiQ3TRM4
TreeFamiTF300519

Enzyme and pathway databases

ReactomeiR-MMU-6814848 Glycerophospholipid catabolism

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q3TRM4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000004565 Expressed in 283 organ(s), highest expression level in cerebellum
ExpressionAtlasiQ3TRM4 baseline and differential
GenevisibleiQ3TRM4 MM

Family and domain databases

CDDicd00038 CAP_ED, 3 hits
Gene3Di2.60.120.10, 3 hits
InterProiView protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR018490 cNMP-bd-like
IPR000595 cNMP-bd_dom
IPR001423 LysoPLipase_patatin_CS
IPR002641 PNPLA_dom
IPR014710 RmlC-like_jellyroll
PfamiView protein in Pfam
PF00027 cNMP_binding, 3 hits
PF01734 Patatin, 1 hit
SMARTiView protein in SMART
SM00100 cNMP, 3 hits
SUPFAMiSSF51206 SSF51206, 3 hits
SSF52151 SSF52151, 1 hit
PROSITEiView protein in PROSITE
PS50042 CNMP_BINDING_3, 3 hits
PS51635 PNPLA, 1 hit
PS01237 UPF0028, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLPL6_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3TRM4
Secondary accession number(s): Q7TQD6, Q9R114
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: September 18, 2019
This is version 115 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again