Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (16 Oct 2019)
Sequence version 2 (06 Feb 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Denticleless protein homolog

Gene

Dtl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Substrate-specific adapter of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex required for cell cycle control, DNA damage response and translesion DNA synthesis. The DCX(DTL) complex, also named CRL4(CDT2) complex, mediates the polyubiquitination and subsequent degradation of CDT1, CDKN1A/p21(CIP1), FBH1, KMT5A and SDE2. CDT1 degradation in response to DNA damage is necessary to ensure proper cell cycle regulation of DNA replication. CDKN1A/p21(CIP1) degradation during S phase or following UV irradiation is essential to control replication licensing. KMT5A degradation is also important for a proper regulation of mechanisms such as TGF-beta signaling, cell cycle progression, DNA repair and cell migration. Most substrates require their interaction with PCNA for their polyubiquitination: substrates interact with PCNA via their PIP-box, and those containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to their degradation. In undamaged proliferating cells, the DCX(DTL) complex also promotes the 'Lys-164' monoubiquitination of PCNA, thereby being involved in PCNA-dependent translesion DNA synthesis. The DDB1-CUL4A-DTL E3 ligase complex regulates the circadian clock function by mediating the ubiquitination and degradation of CRY1 (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processBiological rhythms, DNA damage, DNA replication, Ubl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-110314 Recognition of DNA damage by PCNA-containing replication complex
R-MMU-8951664 Neddylation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Denticleless protein homolog
Alternative name(s):
Lethal(2) denticleless protein homolog
Meth A retinoic acid-regulated nuclear matrix-associated protein
Short name:
Meth A RAMP
Retinoic acid-regulated nuclear matrix-associated protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dtl
Synonyms:Cdt2, L2dtl, Ramp
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1924093 Dtl

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Early embryonic lethality due to cell cycle progression failure, termination of cell division, and, eventually, embryonic death during the preimplantation stage.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002748681 – 729Denticleless protein homologAdd BLAST729

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei196PhosphothreonineBy similarity1
Modified residuei409PhosphoserineBy similarity1
Modified residuei425PhosphoserineBy similarity1
Modified residuei463Phosphothreonine; by CDK1 and CDK2By similarity1
Modified residuei484PhosphoserineBy similarity1
Modified residuei489PhosphoserineBy similarity1
Modified residuei494PhosphoserineBy similarity1
Modified residuei511PhosphoserineCombined sources1
Modified residuei515PhosphothreonineCombined sources1
Modified residuei556PhosphoserineBy similarity1
Modified residuei675PhosphoserineBy similarity1
Modified residuei678PhosphoserineBy similarity1
Modified residuei683PhosphothreonineBy similarity1
Modified residuei701PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by the anaphase promoting complex/cyclosome (APC/C). Autoubiquitinated through 'Lys-48'-polyubiquitin chains in a PCNA-independent reaction, allowing proteasomal turnover. Polyubiquitinated by SCF(FBXO11) when not phosphorylated, leading to its degradation. A tight regulation of the polyubiquitination by SCF(FBXO11) is involved in the control of different processes such as TGF-beta signaling, cell cycle progression and exit (By similarity).By similarity
Phosphorylated at Thr-463 by CDK1/Cyclin B and CDK2/Cycnlin A but not by CDK2/Cyclin E, MAPK1 or PLK1. Phosphorylation at Thr-463 inhibits the interaction with FBXO11 and decreases upon cell cycle exit induced by TGF-beta or serum starvation (By similarity).By similarity

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q3TLR7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3TLR7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3TLR7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3TLR7

PeptideAtlas

More...
PeptideAtlasi
Q3TLR7

PRoteomics IDEntifications database

More...
PRIDEi
Q3TLR7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3TLR7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3TLR7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037474 Expressed in 190 organ(s), highest expression level in zygote

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3TLR7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3TLR7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the DCX(DTL) E3 ubiquitin ligase complex (also called CRL4(CDT2)), at least composed of CUL4 (CUL4A or CUL4B), DDB1, DTL/CDT2 and RBX1 (By similarity).

Interacts with CDKN1A and CDT1 (By similarity).

Interacts with FBXO11; SCF(FBXWO11) controls DTL stability but DCX(DTL) does not control FBXO11 stability (By similarity).

Interacts with CRY1 (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
218345, 32 interactors

Protein interaction database and analysis system

More...
IntActi
Q3TLR7, 31 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000027933

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati47 – 89WD 1Add BLAST43
Repeati96 – 135WD 2Add BLAST40
Repeati138 – 178WD 3Add BLAST41
Repeati214 – 253WD 4Add BLAST40
Repeati269 – 308WD 5Add BLAST40
Repeati313 – 354WD 6Add BLAST42
Repeati358 – 398WD 7Add BLAST41

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi168 – 171DDB1-binding motifBy similarity4
Motifi197 – 203Nuclear localization signalSequence analysis7
Motifi243 – 246DDB1-binding motifBy similarity4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi424 – 546Ser-richAdd BLAST123

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat cdt2 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0321 Eukaryota
ENOG410XRWK LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000064210

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3TLR7

KEGG Orthology (KO)

More...
KOi
K11790

Identification of Orthologs from Complete Genome Data

More...
OMAi
FSGHQNS

Database of Orthologous Groups

More...
OrthoDBi
1288134at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3TLR7

TreeFam database of animal gene trees

More...
TreeFami
TF324483

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00400 WD40, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 5 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3TLR7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLFNSVLRQP QLGVLRNGWS SHYPLQSLLS GYQCNCNDEH TSYGETGVPV
60 70 80 90 100
PPFGCTFCTA PSMEHILAVA NEEGFVRLYN TESQTSKKTC FKEWMAHWNA
110 120 130 140 150
VFDLAWVPGE LKLVTAAGDQ TAKFWDVRAG ELMGTCKGHQ CSLKSVAFPK
160 170 180 190 200
FQKAVFSTGG RDGNIMIWDT RCNKKDGFYR QVNQISGAHN TADKQTPSKP
210 220 230 240 250
KKKQNSKGLA PAVDSQQSVT VVLFQDENTL VSAGAVDGII KVWDLRKNYT
260 270 280 290 300
AYRQEPIASK SFLYPGTSTR KLGYSSLVLD STGSTLFANC TDDNIYMFNM
310 320 330 340 350
TGLKTSPVAV FNGHQNSTFY VKSSLSPDDQ FLISGSSDEA AYIWKVSMPW
360 370 380 390 400
HPPTVLLGHS QEVTSVCWCP SDFTKIATCS DDNTLKIWRL NRGLEEKPGD
410 420 430 440 450
KHSIVGWTSQ KKKEVKACPV TVPSSQSTPA KAPRAKSSPS ISSPSSAACT
460 470 480 490 500
PSCAGDLPLP SSTPTFSVKT TPATTRSSVS RRGSISSVSP KPLSSFKMSL
510 520 530 540 550
RNWVTRTPSS SPPVTPPASE TKISSPRKAL IPVSQKSSQA DACSESRNRV
560 570 580 590 600
KRRLDSSCLE SVKQKCVKSC NCVTELDGQA ESLRLDLCCL SGTQEVLSQD
610 620 630 640 650
SEGPTKSSKT EGAGTSISEP PSPVSPYASE GCGPLPLPLR PCGEGSEMVG
660 670 680 690 700
KENSSPENKN WLLAIAAKRK AENSSPRSPS SQTPSSRRQS GKTSPGPVTI
710 720
TPSSMRKICT YFRRKTQDDF CSPEHSTEL
Length:729
Mass (Da):79,131
Last modified:February 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC828FAFBA9929360
GO
Isoform 2 (identifier: Q3TLR7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     699-729: TITPSSMRKICTYFRRKTQDDFCSPEHSTEL → SLNVGGHMSYLKGTRCSSQDCLGIQANNFALLLH

Note: No experimental confirmation available.
Show »
Length:732
Mass (Da):79,101
Checksum:iE64F9ACAE69103B4
GO
Isoform 3 (identifier: Q3TLR7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-216: DSQ → VR
     217-729: Missing.

Note: No experimental confirmation available.
Show »
Length:215
Mass (Da):23,883
Checksum:i4DBF06F1375457F8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A6YVQ5A0A0A6YVQ5_MOUSE
Denticleless protein homolog
Dtl
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YXS0A0A0A6YXS0_MOUSE
Denticleless protein homolog
Dtl
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAE36376 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BC060208 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti110E → G in BAE36376 (PubMed:16141072).Curated1
Sequence conflicti149P → S in BAE38725 (PubMed:16141072).Curated1
Sequence conflicti200P → L in BAB28549 (PubMed:16141072).Curated1
Sequence conflicti300M → T in BAC76405 (PubMed:12707369).Curated1
Sequence conflicti300M → T in BAC76404 (PubMed:12707369).Curated1
Sequence conflicti369C → Y in BAC76405 (PubMed:12707369).Curated1
Sequence conflicti369C → Y in BAC76404 (PubMed:12707369).Curated1
Sequence conflicti593T → A in BAE38725 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_022884214 – 216DSQ → VR in isoform 3. 1 Publication3
Alternative sequenceiVSP_022885217 – 729Missing in isoform 3. 1 PublicationAdd BLAST513
Alternative sequenceiVSP_022886699 – 729TITPS…HSTEL → SLNVGGHMSYLKGTRCSSQD CLGIQANNFALLLH in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB095735 mRNA Translation: BAC76404.1
AB095736 mRNA Translation: BAC76405.1
AK012919 mRNA Translation: BAB28549.1
AK054412 mRNA Translation: BAC35769.1
AK133177 mRNA Translation: BAE21543.1
AK161401 mRNA Translation: BAE36376.1 Different initiation.
AK166351 mRNA Translation: BAE38725.1
BC060208 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS15621.1 [Q3TLR7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001292162.1, NM_001305233.1
NP_084042.1, NM_029766.3 [Q3TLR7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000027933; ENSMUSP00000027933; ENSMUSG00000037474 [Q3TLR7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
76843

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:76843

UCSC genome browser

More...
UCSCi
uc007eck.2 mouse [Q3TLR7-1]
uc007ecn.2 mouse [Q3TLR7-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095735 mRNA Translation: BAC76404.1
AB095736 mRNA Translation: BAC76405.1
AK012919 mRNA Translation: BAB28549.1
AK054412 mRNA Translation: BAC35769.1
AK133177 mRNA Translation: BAE21543.1
AK161401 mRNA Translation: BAE36376.1 Different initiation.
AK166351 mRNA Translation: BAE38725.1
BC060208 mRNA No translation available.
CCDSiCCDS15621.1 [Q3TLR7-1]
RefSeqiNP_001292162.1, NM_001305233.1
NP_084042.1, NM_029766.3 [Q3TLR7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi218345, 32 interactors
IntActiQ3TLR7, 31 interactors
STRINGi10090.ENSMUSP00000027933

PTM databases

iPTMnetiQ3TLR7
PhosphoSitePlusiQ3TLR7

Proteomic databases

EPDiQ3TLR7
jPOSTiQ3TLR7
MaxQBiQ3TLR7
PaxDbiQ3TLR7
PeptideAtlasiQ3TLR7
PRIDEiQ3TLR7

Genome annotation databases

EnsembliENSMUST00000027933; ENSMUSP00000027933; ENSMUSG00000037474 [Q3TLR7-1]
GeneIDi76843
KEGGimmu:76843
UCSCiuc007eck.2 mouse [Q3TLR7-1]
uc007ecn.2 mouse [Q3TLR7-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51514
MGIiMGI:1924093 Dtl

Phylogenomic databases

eggNOGiKOG0321 Eukaryota
ENOG410XRWK LUCA
GeneTreeiENSGT00530000064210
InParanoidiQ3TLR7
KOiK11790
OMAiFSGHQNS
OrthoDBi1288134at2759
PhylomeDBiQ3TLR7
TreeFamiTF324483

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-MMU-110314 Recognition of DNA damage by PCNA-containing replication complex
R-MMU-8951664 Neddylation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dtl mouse

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037474 Expressed in 190 organ(s), highest expression level in zygote
ExpressionAtlasiQ3TLR7 baseline and differential
GenevisibleiQ3TLR7 MM

Family and domain databases

Gene3Di2.130.10.10, 2 hits
InterProiView protein in InterPro
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00400 WD40, 5 hits
SMARTiView protein in SMART
SM00320 WD40, 5 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 5 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDTL_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3TLR7
Secondary accession number(s): Q3TTE9
, Q6PAN1, Q80WY1, Q80WY2, Q8BW38, Q9CZ76
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: October 16, 2019
This is version 126 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again