Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin protein zero-like protein 1

Gene

Mpzl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cell surface receptor, which is involved in signal transduction processes. Recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. Is a major receptor for concanavalin-A (ConA) and is involved in cellular signaling induced by ConA, which probably includes Src family tyrosine-protein kinases. Isoform 2 seems to have a dominant negative role; it blocks tyrosine phosphorylation of MPZL1 induced by ConA. Isoform 1, but not isoform 2, may be involved in regulation of integrin-mediated cell motility (By similarity).By similarity

GO - Biological processi

  • positive regulation of cell migration Source: MGI
  • signal transduction Source: InterPro

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin protein zero-like protein 1
Alternative name(s):
Protein zero-related
Gene namesi
Name:Mpzl1
Synonyms:Pzr
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1915731 Mpzl1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini36 – 162ExtracellularSequence analysisAdd BLAST127
Transmembranei163 – 183HelicalSequence analysisAdd BLAST21
Topological domaini184 – 270CytoplasmicSequence analysisAdd BLAST87

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 35Sequence analysisAdd BLAST35
ChainiPRO_000024033636 – 270Myelin protein zero-like protein 1Add BLAST235

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi50N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi58 ↔ 135PROSITE-ProRule annotation
Glycosylationi130N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei204PhosphoserineBy similarity1
Modified residuei206PhosphoserineBy similarity1
Modified residuei210PhosphoserineBy similarity1
Modified residuei221PhosphoserineBy similarity1
Modified residuei242PhosphotyrosineBy similarity1
Modified residuei261PhosphoserineBy similarity1
Modified residuei264PhosphotyrosineBy similarity1

Post-translational modificationi

Phosphorylated on tyrosine residues upon stimulation with pervanadate and concanavalin-A (ConA). Phosphorylation at Tyr-242 and Tyr-264 is required for interaction with PTPN11/SHP-2. Dephosphorylated by PTPN11/SHP-2 (in vitro) (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ3TEW6
PaxDbiQ3TEW6
PeptideAtlasiQ3TEW6
PRIDEiQ3TEW6

PTM databases

iPTMnetiQ3TEW6
PhosphoSitePlusiQ3TEW6

Expressioni

Gene expression databases

BgeeiENSMUSG00000026566 Expressed in 246 organ(s), highest expression level in utricle of membranous labyrinth
CleanExiMM_MPZL1
ExpressionAtlasiQ3TEW6 baseline and differential
GenevisibleiQ3TEW6 MM

Interactioni

Subunit structurei

Interacts with phosphorylated PTPN11/SHP-2.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000107062

Structurei

3D structure databases

ProteinModelPortaliQ3TEW6
SMRiQ3TEW6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 151Ig-like V-typeAdd BLAST116

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi240 – 245ITIM motif 16
Motifi262 – 267ITIM motif 26

Domaini

Sequence similaritiesi

Belongs to the myelin P0 protein family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IVXC Eukaryota
ENOG4111MDZ LUCA
GeneTreeiENSGT00900000140913
HOGENOMiHOG000232144
HOVERGENiHBG104511
InParanoidiQ3TEW6
KOiK06770
OrthoDBiEOG091G0H91
PhylomeDBiQ3TEW6
TreeFamiTF331728

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR029870 MPZL1
IPR000920 Myelin_P0-rel
PANTHERiPTHR13869 PTHR13869, 1 hit
PTHR13869:SF19 PTHR13869:SF19, 1 hit
PfamiView protein in Pfam
PF07686 V-set, 1 hit
PRINTSiPR00213 MYELINP0
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3TEW6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAVGAVAL IAAPARRRWL WSVLAAMLGL LTARISALEV HTPKEIFVVN
60 70 80 90 100
GTQGKLTCTF DSPNTTGWLT TVSWSFQPDG TDSAVSFFHY SQGQVYIGDY
110 120 130 140 150
PPFKDRVTWA GDLDKKDASI NIENIQAVHN GTYICDVKNP PDIVVRPGHI
160 170 180 190 200
RLHVVEIDNL LVFLVWVVVG TVTAVVLGLT LLISLVLVVL YRRKHSKRDY
210 220 230 240 250
TGCSTSERLS PVKQAPRKCP SDTEGLVKSP PSAGSHQGPV IYAQLDHSGG
260 270
HHSGKINKSE SVVYADIRKD
Length:270
Mass (Da):29,495
Last modified:October 11, 2005 - v1
Checksum:i1E033F0F5F732C22
GO
Isoform 2 (identifier: Q3TEW6-2) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     203-270: CSTSERLSPVKQAPRKCPSDTEGLVKSPPSAGSHQGPVIYAQLDHSGGHHSGKINKSESVVYADIRKD → AQSFT

Show »
Length:207
Mass (Da):22,820
Checksum:i390F451D11FDBE02
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J0V2A0A0R4J0V2_MOUSE
Myelin protein zero-like 1, isoform...
Mpzl1 mCG_8371
209Annotation score:
A0A0A6YWA2A0A0A6YWA2_MOUSE
Myelin protein zero-like protein 1
Mpzl1
248Annotation score:
A0A0A6YXW1A0A0A6YXW1_MOUSE
Myelin protein zero-like protein 1
Mpzl1
119Annotation score:
A0A0A6YW22A0A0A6YW22_MOUSE
Myelin protein zero-like protein 1
Mpzl1
183Annotation score:
A0A0A6YX14A0A0A6YX14_MOUSE
Myelin protein zero-like protein 1
Mpzl1
126Annotation score:
A0A0A6YXX8A0A0A6YXX8_MOUSE
Myelin protein zero-like protein 1
Mpzl1
82Annotation score:
A0A0A6YXL8A0A0A6YXL8_MOUSE
Myelin protein zero-like protein 1
Mpzl1
44Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti202G → GFIS in AAX11678 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019345203 – 270CSTSE…DIRKD → AQSFT in isoform 2. 2 PublicationsAdd BLAST68

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK169385 mRNA Translation: BAE41132.1
AY764247 mRNA Translation: AAX11678.1
AY764248 mRNA Translation: AAX11679.1
BC072563 mRNA Translation: AAH72563.1
CCDSiCCDS35757.1 [Q3TEW6-1]
RefSeqiNP_001001880.1, NM_001001880.2
NP_001077366.1, NM_001083897.1 [Q3TEW6-1]
UniGeneiMm.46438

Genome annotation databases

EnsembliENSMUST00000111435; ENSMUSP00000107062; ENSMUSG00000026566 [Q3TEW6-1]
GeneIDi68481
KEGGimmu:68481
UCSCiuc007djh.1 mouse [Q3TEW6-1]
uc007dji.1 mouse [Q3TEW6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK169385 mRNA Translation: BAE41132.1
AY764247 mRNA Translation: AAX11678.1
AY764248 mRNA Translation: AAX11679.1
BC072563 mRNA Translation: AAH72563.1
CCDSiCCDS35757.1 [Q3TEW6-1]
RefSeqiNP_001001880.1, NM_001001880.2
NP_001077366.1, NM_001083897.1 [Q3TEW6-1]
UniGeneiMm.46438

3D structure databases

ProteinModelPortaliQ3TEW6
SMRiQ3TEW6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000107062

PTM databases

iPTMnetiQ3TEW6
PhosphoSitePlusiQ3TEW6

Proteomic databases

MaxQBiQ3TEW6
PaxDbiQ3TEW6
PeptideAtlasiQ3TEW6
PRIDEiQ3TEW6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000111435; ENSMUSP00000107062; ENSMUSG00000026566 [Q3TEW6-1]
GeneIDi68481
KEGGimmu:68481
UCSCiuc007djh.1 mouse [Q3TEW6-1]
uc007dji.1 mouse [Q3TEW6-2]

Organism-specific databases

CTDi9019
MGIiMGI:1915731 Mpzl1

Phylogenomic databases

eggNOGiENOG410IVXC Eukaryota
ENOG4111MDZ LUCA
GeneTreeiENSGT00900000140913
HOGENOMiHOG000232144
HOVERGENiHBG104511
InParanoidiQ3TEW6
KOiK06770
OrthoDBiEOG091G0H91
PhylomeDBiQ3TEW6
TreeFamiTF331728

Miscellaneous databases

ChiTaRSiMpzl1 mouse
PROiPR:Q3TEW6
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000026566 Expressed in 246 organ(s), highest expression level in utricle of membranous labyrinth
CleanExiMM_MPZL1
ExpressionAtlasiQ3TEW6 baseline and differential
GenevisibleiQ3TEW6 MM

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR029870 MPZL1
IPR000920 Myelin_P0-rel
PANTHERiPTHR13869 PTHR13869, 1 hit
PTHR13869:SF19 PTHR13869:SF19, 1 hit
PfamiView protein in Pfam
PF07686 V-set, 1 hit
PRINTSiPR00213 MYELINP0
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMPZL1_MOUSE
AccessioniPrimary (citable) accession number: Q3TEW6
Secondary accession number(s): Q2VW02, Q6GQX5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: October 11, 2005
Last modified: November 7, 2018
This is version 97 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again